P07766 · CD3E_HUMAN
- ProteinT-cell surface glycoprotein CD3 epsilon chain
- GeneCD3E
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids207 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways (PubMed:2470098).
In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region (PubMed:10384095, PubMed:26507128).
In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region (PubMed:10384095, PubMed:26507128).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameT-cell surface glycoprotein CD3 epsilon chain
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP07766
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 23-126 | Extracellular | ||||
Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD | ||||||
Transmembrane | 127-152 | Helical | ||||
Sequence: VMSVATIVIVDICITGGLLLLVYYWS | ||||||
Topological domain | 153-207 | Cytoplasmic | ||||
Sequence: KNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Immunodeficiency 18 (IMD18)
- Note
- DescriptionAn autosomal recessive primary immunodeficiency characterized by onset in infancy or early childhood of recurrent infections. The severity is variable, encompassing both a mild immunodeficiency and severe combined immunodeficiency (SCID), resulting in early death without bone marrow transplantation in some patients. Immunologic work-up of the IMD18 SCID patients shows a T cell-negative, B cell-positive, natural killer (NK) cell-positive phenotype, whereas T-cell development is not impaired in the mild form of IMD18.
- See alsoMIM:615615
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 232 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Signal | 1-22 | UniProt | |||||
Sequence: MQSGTHWRVLGLCLLSVGVWGQ | |||||||
Chain | PRO_0000014607 | 23-207 | UniProt | T-cell surface glycoprotein CD3 epsilon chain | |||
Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI | |||||||
Disulfide bond | 49↔98 | UniProt | |||||
Sequence: CPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVC | |||||||
Modified residue | 188 | UniProt | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 188 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 199 | UniProt | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 199 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 200 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
The TCR-CD3 complex is composed of a CD3D/CD3E and a CD3G/CD3E heterodimers that preferentially associate with TCRalpha and TCRbeta, respectively, to form TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. In turn, the hexamer interacts with CD3Z homodimer to form the TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta. Interacts with CD6 (PubMed:15294938).
Interacts with NCK1 (PubMed:15972658).
Interacts with NUMB; this interaction is important for TCR-CD3 internalization and subsequent degradation (PubMed:26507128).
Interacts with NCK1 (PubMed:15972658).
Interacts with NUMB; this interaction is important for TCR-CD3 internalization and subsequent degradation (PubMed:26507128).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P07766 | ADAM33 Q08AM2 | 3 | EBI-1211297, EBI-10225815 | |
BINARY | P07766 | BNIP3 Q12983 | 3 | EBI-1211297, EBI-749464 | |
BINARY | P07766 | EPS8L1 Q8TE68 | 6 | EBI-1211297, EBI-7487998 | |
BINARY | P07766 | MUC15 Q8N387 | 3 | EBI-1211297, EBI-17937277 | |
BINARY | P07766 | NCK1 P16333 | 6 | EBI-1211297, EBI-389883 | |
BINARY | P07766 | NCK2 O43639 | 4 | EBI-1211297, EBI-713635 | |
BINARY | P07766 | PKMYT1 Q99640-2 | 3 | EBI-1211297, EBI-12257782 | |
BINARY | P07766 | SYK P43405 | 6 | EBI-1211297, EBI-78302 | |
BINARY | P07766 | ZAP70 P43403 | 3 | EBI-1211297, EBI-1211276 | |
BINARY | P07766 | ZFPL1 O95159 | 3 | EBI-1211297, EBI-718439 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 32-112 | Ig-like | ||||
Sequence: TQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYL | ||||||
Region | 161-207 | Disordered | ||||
Sequence: PVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI | ||||||
Region | 175-192 | NUMB-binding region | ||||
Sequence: QNKERPPPVPNPDYEPIR | ||||||
Domain | 178-205 | ITAM | ||||
Sequence: ERPPPVPNPDYEPIRKGQRDLYSGLNQR |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length207
- Mass (Da)23,147
- Last updated1996-02-01 v2
- ChecksumA1603D01CE9957D7
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E9PSH8 | E9PSH8_HUMAN | CD3E | 201 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X03884 EMBL· GenBank· DDBJ | CAA27516.1 EMBL· GenBank· DDBJ | mRNA | ||
M23323 EMBL· GenBank· DDBJ | AAA52295.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M23317 EMBL· GenBank· DDBJ | AAA52295.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M23318 EMBL· GenBank· DDBJ | AAA52295.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M23319 EMBL· GenBank· DDBJ | AAA52295.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M23320 EMBL· GenBank· DDBJ | AAA52295.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M23321 EMBL· GenBank· DDBJ | AAA52295.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L34846 EMBL· GenBank· DDBJ | AAA52295.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M23322 EMBL· GenBank· DDBJ | AAA52295.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK292612 EMBL· GenBank· DDBJ | BAF85301.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471065 EMBL· GenBank· DDBJ | EAW67364.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC049847 EMBL· GenBank· DDBJ | AAH49847.1 EMBL· GenBank· DDBJ | mRNA |