P07664 · SRYD_DROME
- ProteinSerendipity locus protein delta
- GeneSry-delta
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids433 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcriptional activator that controls bicoid gene expression during oogenesis. Found in transcriptionally active cells. Binds to specific sites on polytene chromosomes of third instar larvae. Binds to the consensus DNA sequence 5'-YTAGAGATGGRAA-3'.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Cellular Component | polytene chromosome interband | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription activator activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | metal ion binding | |
Molecular Function | RNA polymerase II transcription regulatory region sequence-specific DNA binding | |
Biological Process | anterior/posterior axis specification, embryo | |
Biological Process | bicoid mRNA localization | |
Biological Process | oogenesis | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | sexual reproduction |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameSerendipity locus protein delta
- Short namesSerendipity-delta
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP07664
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000047050 | 1-433 | Serendipity locus protein delta | |||
Sequence: MDTCFFCGAVDLSDTGSSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLKPGARLCPRCFQELSDYDTIMVNLMTTQKRLTTQLKGALKSEFEVPESGEDILVEEVEIPQSDVETDADAEADALFVELVKDQEESDTEIKREFVDEEEEEDDDDDDEFICEDVDVGDSEALYGKSSDGEDRPTKKRVKQECTTCGKVYNSWYQLQKHISEEHSKQPNHICPICGVIRRDEEYLELHMNLHEGKTEKQCRYCPKSFSRPVNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICSICNVSFKSRKTFNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEGDVVYGVREEAPADEQQVVEELHVDVDESEAAVTVIMSDNDENSGFCLICNTNFENKKELEHHLQFDHDVVLK |
Proteomic databases
Expression
Tissue specificity
Predominantly localized to the sub- and supraesophagal ganglia and the ventral nerve cord in the embryo, after dorsal closure.
Developmental stage
Expressed both maternally and zygotically. Found in ovaries and abundant in early embryos. Also found in variable amounts at every stage of the life cycle.
Gene expression databases
Interaction
Subunit
Homodimer (via ZAD domain) in solution (PubMed:35580610).
Binds DNA as a homodimer. N-terminal regions of the protein are required, in addition to the zinc fingers, for the specificity of chromatin-binding
Binds DNA as a homodimer. N-terminal regions of the protein are required, in addition to the zinc fingers, for the specificity of chromatin-binding
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P07664 | BEAF-32 Q7JN06 | 4 | EBI-498092, EBI-134484 | |
BINARY | P07664 | BEAF-32 Q94513 | 3 | EBI-498092, EBI-366851 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, motif, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-90 | ZAD | ||||
Sequence: MDTCFFCGAVDLSDTGSSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLKPGARLCPRCFQELSDYDTIMVNLMTTQKRLTTQLK | ||||||
Region | 141-162 | Disordered | ||||
Sequence: DTEIKREFVDEEEEEDDDDDDE | ||||||
Compositional bias | 145-162 | Acidic residues | ||||
Sequence: KREFVDEEEEEDDDDDDE | ||||||
Motif | 187-193 | Nuclear localization signal | ||||
Sequence: PTKKRVK | ||||||
Zinc finger | 194-217 | C2H2-type 1 | ||||
Sequence: QECTTCGKVYNSWYQLQKHISEEH | ||||||
Zinc finger | 223-245 | C2H2-type 2 | ||||
Sequence: HICPICGVIRRDEEYLELHMNLH | ||||||
Zinc finger | 251-273 | C2H2-type 3 | ||||
Sequence: KQCRYCPKSFSRPVNTLRHMRMH | ||||||
Zinc finger | 279-301 | C2H2-type 4 | ||||
Sequence: YQCEKCGLRFSQDNLLYNHRLRH | ||||||
Zinc finger | 308-330 | C2H2-type 5 | ||||
Sequence: IICSICNVSFKSRKTFNHHTLIH | ||||||
Zinc finger | 337-359 | C2H2-type 6 | ||||
Sequence: HYCSVCPKSFTERYTLKMHMKTH | ||||||
Zinc finger | 405-428 | C2H2-type 7 | ||||
Sequence: GFCLICNTNFENKKELEHHLQFDH |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length433
- Mass (Da)50,028
- Last updated2005-08-16 v2
- Checksum9F89FB7696ECF3F7
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 62 | in Ref. 1; CAA26898 | ||||
Sequence: Missing | ||||||
Compositional bias | 145-162 | Acidic residues | ||||
Sequence: KREFVDEEEEEDDDDDDE | ||||||
Sequence conflict | 272 | in Ref. 1; CAA26898 | ||||
Sequence: M → S | ||||||
Sequence conflict | 393 | in Ref. 1 and 5 | ||||
Sequence: V → F | ||||||
Sequence conflict | 413 | in Ref. 1 and 5 | ||||
Sequence: N → T | ||||||
Sequence conflict | 431-433 | in Ref. 1 and 5 | ||||
Sequence: VLK → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X03121 EMBL· GenBank· DDBJ | CAA26898.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF57000.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY069691 EMBL· GenBank· DDBJ | AAL39836.1 EMBL· GenBank· DDBJ | mRNA | ||
X00555 EMBL· GenBank· DDBJ | CAA25221.1 EMBL· GenBank· DDBJ | Genomic DNA |