P07091 · S10A4_MOUSE
- ProteinProtein S100-A4
- GeneS100a4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids101 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy (PubMed:20519440).
Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9 (PubMed:8051043).
Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis (PubMed:8051043).
Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels (By similarity).
Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes (PubMed:20103644).
In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors (By similarity).
Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9 (PubMed:8051043).
Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis (PubMed:8051043).
Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels (By similarity).
Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes (PubMed:20103644).
In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors (By similarity).
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 28 | Ca2+ 1 (UniProtKB | ChEBI); low affinity | ||||
Sequence: K | ||||||
Binding site | 33 | Ca2+ 1 (UniProtKB | ChEBI); low affinity | ||||
Sequence: E | ||||||
Binding site | 63 | Ca2+ 2 (UniProtKB | ChEBI); high affinity | ||||
Sequence: D | ||||||
Binding site | 65 | Ca2+ 2 (UniProtKB | ChEBI); high affinity | ||||
Sequence: N | ||||||
Binding site | 67 | Ca2+ 2 (UniProtKB | ChEBI); high affinity | ||||
Sequence: D | ||||||
Binding site | 69 | Ca2+ 2 (UniProtKB | ChEBI); high affinity | ||||
Sequence: E | ||||||
Binding site | 74 | Ca2+ 2 (UniProtKB | ChEBI); high affinity | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | extracellular space | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | perinuclear region of cytoplasm | |
Molecular Function | actin binding | |
Molecular Function | calcium ion binding | |
Molecular Function | calcium-dependent protein binding | |
Molecular Function | chemoattractant activity | |
Molecular Function | identical protein binding | |
Molecular Function | RAGE receptor binding | |
Molecular Function | transition metal ion binding | |
Biological Process | positive regulation of canonical NF-kappaB signal transduction |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameProtein S100-A4
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP07091
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Disruption phenotype
Deletion mice are fertile, grow normally and exhibit no overt abnormalities; however loss of S100A4 results in impaired recruitment of macrophages to sites of inflammation in vivo (PubMed:20519440).
Mice also show decreased metastatic burden in lungs of PyMT-induced mammary tumors which is associated with reduced vessel density (PubMed:20103644).
Mice also show decreased metastatic burden in lungs of PyMT-induced mammary tumors which is associated with reduced vessel density (PubMed:20103644).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 4 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000143978 | 2-101 | Protein S100-A4 | |||
Sequence: ARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK | ||||||
Modified residue | 35 | N6-acetyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Specifically expressed in different metastatic cells.
Induction
The mRNA coding for this protein increases in abundance after serum stimulation of quiescent mouse fibroblasts.
Gene expression databases
Interaction
Subunit
Homodimer. Interacts with PPFIBP1 in a calcium-dependent mode. Interacts with PGLYRP1; this complex acts as a chemoattractant that promotes lymphocyte movement. Interacts with MYH9; this interaction increases cell motility. Interacts with Annexin 2/ANXA2. Interacts with TP53; this interaction promotes TP53 degradation. Interacts with CCR5 and CXCR3. Interacts with FCGR3A; this interaction inhibits PKC-dependent phosphorylation of FCGR3A.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P07091 | S100a1 P56565 | 6 | EBI-1544173, EBI-1544186 | |
BINARY | P07091 | S100a4 P07091 | 4 | EBI-1544173, EBI-1544173 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 12-47 | EF-hand 1 | ||||
Sequence: IVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLG | ||||||
Domain | 50-85 | EF-hand 2 | ||||
Sequence: TDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMM |
Sequence similarities
Belongs to the S-100 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length101
- Mass (Da)11,721
- Last updated1988-04-01 v1
- Checksum2302254B67A4C873
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0G2JGD2 | A0A0G2JGD2_MOUSE | S100a4 | 78 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 47 | in Ref. 5; CAA34224 | ||||
Sequence: G → GVSGSXFNGQ |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X05835 EMBL· GenBank· DDBJ | CAA29282.1 EMBL· GenBank· DDBJ | mRNA | ||
D00208 EMBL· GenBank· DDBJ | BAA00148.1 EMBL· GenBank· DDBJ | mRNA | ||
X16190 EMBL· GenBank· DDBJ | CAA34316.1 EMBL· GenBank· DDBJ | mRNA | ||
M36578 EMBL· GenBank· DDBJ | AAA39749.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M36579 EMBL· GenBank· DDBJ | AAA39750.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X16094 EMBL· GenBank· DDBJ | CAA34224.1 EMBL· GenBank· DDBJ | Genomic DNA |