P06838 · RAD10_YEAST
- ProteinDNA repair protein RAD10
- GeneRAD10
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids210 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in nucleotide excision repair of DNA damaged with UV light, bulky adducts, or cross-linking agents. Along with RAD1 forms an endonuclease that specifically degrades single-stranded DNA.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 133-153 | |||||
Sequence: RSVLFLTLTYHKLYVDYISRR |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endonuclease complex | |
Cellular Component | nucleotide-excision repair factor 1 complex | |
Cellular Component | nucleus | |
Molecular Function | damaged DNA binding | |
Molecular Function | endonuclease activity | |
Molecular Function | single-stranded DNA binding | |
Biological Process | DNA amplification | |
Biological Process | double-strand break repair via single-strand annealing, removal of nonhomologous ends | |
Biological Process | meiotic mismatch repair | |
Biological Process | mitotic recombination | |
Biological Process | nucleotide-excision repair | |
Biological Process | nucleotide-excision repair, DNA damage recognition | |
Biological Process | removal of nonhomologous ends |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA repair protein RAD10
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP06838
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000097149 | 1-210 | DNA repair protein RAD10 | |||
Sequence: MNNTDPTSFESILAGVAKLRKEKSGADTTGSQSLEIDASKLQQQEPQTSRRINSNQVINAFNQQKPEEWTDSKATDDYNRKRPFRSTRPGKTVLVNTTQKENPLLNHLKSTNWRYVSSTGINMIYYDYLVRGRSVLFLTLTYHKLYVDYISRRMQPLSRNENNILIFIVDDNNSEDTLNDITKLCMFNGFTLLLAFNFEQAAKYIEYLNL |
Proteomic databases
PTM databases
Interaction
Subunit
Component of the nucleotide excision repair factor 1 (NEF1) complex consisting of RAD1, RAD10 and RAD14. Interacts with SAW1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P06838 | RAD1 P06777 | 12 | EBI-14637, EBI-14752 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 17-23 | Nuclear localization signal | ||||
Sequence: AKLRKEK | ||||||
Region | 20-89 | Disordered | ||||
Sequence: RKEKSGADTTGSQSLEIDASKLQQQEPQTSRRINSNQVINAFNQQKPEEWTDSKATDDYNRKRPFRSTRP | ||||||
Compositional bias | 26-68 | Polar residues | ||||
Sequence: ADTTGSQSLEIDASKLQQQEPQTSRRINSNQVINAFNQQKPEE | ||||||
Compositional bias | 69-84 | Basic and acidic residues | ||||
Sequence: WTDSKATDDYNRKRPF |
Sequence similarities
Belongs to the ERCC1/RAD10/SWI10 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length210
- Mass (Da)24,311
- Last updated1988-01-01 v1
- Checksum26891AD9CA1E3E2B
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 26-68 | Polar residues | ||||
Sequence: ADTTGSQSLEIDASKLQQQEPQTSRRINSNQVINAFNQQKPEE | ||||||
Compositional bias | 69-84 | Basic and acidic residues | ||||
Sequence: WTDSKATDDYNRKRPF |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X02591 EMBL· GenBank· DDBJ | CAA26433.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X05225 EMBL· GenBank· DDBJ | CAA28856.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z46660 EMBL· GenBank· DDBJ | CAA86642.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006946 EMBL· GenBank· DDBJ | DAA09804.1 EMBL· GenBank· DDBJ | Genomic DNA |