P06704 · CDC31_YEAST
- ProteinCell division control protein 31
- GeneCDC31
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids161 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Functions as a component of the spindle pole body (SPB) half-bridge (PubMed:10684247, PubMed:11156974, PubMed:12486115, PubMed:14504268, PubMed:8070654).
At the SPB, it is recruited by KAR1 and MPS3 to the SPB half-bridge and involved in the initial steps of SPB duplication (PubMed:11156974, PubMed:12486115, PubMed:14504268, PubMed:8070654).
Also involved in connection with the protein kinase KIC1 in the maintenance of cell morphology and integrity (PubMed:9813095).
May play a role in vesicle-mediated transport, in a VPS13-dependent manner (PubMed:28122955).
At the SPB, it is recruited by KAR1 and MPS3 to the SPB half-bridge and involved in the initial steps of SPB duplication (PubMed:11156974, PubMed:12486115, PubMed:14504268, PubMed:8070654).
Also involved in connection with the protein kinase KIC1 in the maintenance of cell morphology and integrity (PubMed:9813095).
May play a role in vesicle-mediated transport, in a VPS13-dependent manner (PubMed:28122955).
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 33 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 35 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 37 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 44 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 142 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 144 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 146 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 148 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 153 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | half bridge of spindle pole body | |
Cellular Component | mitotic spindle pole body | |
Cellular Component | nuclear envelope | |
Cellular Component | transcription export complex 2 | |
Molecular Function | calcium ion binding | |
Molecular Function | identical protein binding | |
Molecular Function | microtubule binding | |
Biological Process | cell division | |
Biological Process | Golgi vesicle transport | |
Biological Process | microtubule cytoskeleton organization | |
Biological Process | mRNA export from nucleus | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | proteasome-mediated ubiquitin-dependent protein catabolic process | |
Biological Process | spindle pole body duplication |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCell division control protein 31
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP06704
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000073577 | 1-161 | Cell division control protein 31 | |||
Sequence: MSKNRSSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS | ||||||
Modified residue | 130 | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Component of the spindle pole body (SPB), acting as the connector of microtubule arrays in the cytoplasm and the nucleoplasm, is involved in nuclear positioning before chromosome segregation, SPB separation, spindle formation, chromosome segregation, nuclear migration into the bud, nuclear reorientation after cytokinesis and nuclear fusion during conjugation. The SPB half-bridge, which is tightly associated with the cytoplasmic side of the nuclear envelope and the SPB, is playing a key role as the starting structure for and in the initiation of SPB duplication in G1. At the SPB half-bridge CDC31 interacts with KAR1, MPS3 and SFI1 (PubMed:12486115, PubMed:14504268).
Interacts with KIC1 (PubMed:9813095).
Interacts with VPS13 (PubMed:28122955).
Associates with nuclear pore complexes (NPCs) (PubMed:10684247).
Interacts with KIC1 (PubMed:9813095).
Interacts with VPS13 (PubMed:28122955).
Associates with nuclear pore complexes (NPCs) (PubMed:10684247).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P06704 | CDC31 P06704 | 2 | EBI-4259, EBI-4259 | |
BINARY | P06704 | MPS3 P47069 | 2 | EBI-4259, EBI-25811 | |
BINARY | P06704 | SAC3 P46674 | 10 | EBI-4259, EBI-16425 | |
BINARY | P06704 | SFI1 Q12369 | 3 | EBI-4259, EBI-2213082 | |
BINARY | P06704 | SUS1 Q6WNK7 | 6 | EBI-4259, EBI-1251050 | |
BINARY | P06704 | THP1 Q08231 | 4 | EBI-4259, EBI-32097 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 20-55 | EF-hand 1 | ||||
Sequence: EQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFE | ||||||
Domain | 56-91 | EF-hand 2 | ||||
Sequence: LPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILK | ||||||
Domain | 93-128 | EF-hand 3 | ||||
Sequence: DPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGET | ||||||
Domain | 129-161 | EF-hand 4 | ||||
Sequence: LTDEELRAMIEEFDLDGDGEINENEFIAICTDS |
Sequence similarities
Belongs to the centrin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length161
- Mass (Da)18,751
- Last updated1995-02-01 v2
- Checksum25A546E76E1EF520
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 77 | in Ref. 1; AAA66893 | ||||
Sequence: K → L | ||||||
Sequence conflict | 110 | in Ref. 1; AAA66893 | ||||
Sequence: T → I |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M14078 EMBL· GenBank· DDBJ | AAA66893.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X74500 EMBL· GenBank· DDBJ | CAA52609.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z75165 EMBL· GenBank· DDBJ | CAA99479.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY558434 EMBL· GenBank· DDBJ | AAS56760.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006948 EMBL· GenBank· DDBJ | DAA11024.1 EMBL· GenBank· DDBJ | Genomic DNA |