P06602 · EVE_DROME
- ProteinSegmentation protein even-skipped
- Geneeve
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids376 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May play a role in determining neuronal identity. May be directly involved in specifying identity of individual neurons. Pair-rule protein required for segmentation; involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 70-129 | Homeobox | ||||
Sequence: VRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQR |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSegmentation protein even-skipped
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP06602
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000049060 | 1-376 | Segmentation protein even-skipped | |||
Sequence: MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRIAVAWPYAAVYSDPAFAASILQAAANSVGMPYPPYAPAAAAAAAAAAAVATNPMMATGMPPMGMPQMPTMQMPGHSGHAGHPSPYGQYRYTPYHIPARPAPPHPAGPHMHHPHMMGSSATGSSYSAGAAGLLGALPSATCYTGLGVGVPKTQTPPLDLQSSSSPHSSTLSLSPVGSDHAKVFDRSPVAQSAPSVPAPAPLTTTSPLPAPGLLMPSAKRPASDMSPPPTTTVIAEPKPKLFKPYKTEA |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: MHGYRTYNMESHHAHHDASPVD | ||||||
Region | 34-67 | Disordered | ||||
Sequence: QYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPAD | ||||||
Region | 229-248 | Disordered | ||||
Sequence: APPHPAGPHMHHPHMMGSSA | ||||||
Region | 281-376 | Disordered | ||||
Sequence: QTPPLDLQSSSSPHSSTLSLSPVGSDHAKVFDRSPVAQSAPSVPAPAPLTTTSPLPAPGLLMPSAKRPASDMSPPPTTTVIAEPKPKLFKPYKTEA | ||||||
Compositional bias | 282-303 | Polar residues | ||||
Sequence: TPPLDLQSSSSPHSSTLSLSPV |
Sequence similarities
Belongs to the even-skipped homeobox family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length376
- Mass (Da)39,970
- Last updated2000-12-01 v3
- Checksum59058E0634B1BED0
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 282-303 | Polar residues | ||||
Sequence: TPPLDLQSSSSPHSSTLSLSPV | ||||||
Sequence conflict | 300 | in Ref. 1; AAA28522 | ||||
Sequence: L → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M14767 EMBL· GenBank· DDBJ | AAA28522.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X05138 EMBL· GenBank· DDBJ | CAA28784.1 EMBL· GenBank· DDBJ | mRNA | ||
AE013599 EMBL· GenBank· DDBJ | AAF58865.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U32087 EMBL· GenBank· DDBJ | AAB05358.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U32088 EMBL· GenBank· DDBJ | AAB05359.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U32089 EMBL· GenBank· DDBJ | AAB05360.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U32090 EMBL· GenBank· DDBJ | AAB05361.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U32091 EMBL· GenBank· DDBJ | AAB05362.1 EMBL· GenBank· DDBJ | Genomic DNA |