P06481 · US9_HHV11
- ProteinEnvelope protein US9
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Essential for the anterograde spread of the infection throughout the host nervous system. Together with the gE/gI heterodimer, US9 is involved in the sorting and transport of viral structural components toward axon tips.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell | |
Cellular Component | host cell Golgi membrane | |
Cellular Component | host cell plasma membrane | |
Cellular Component | host cell smooth endoplasmic reticulum membrane | |
Cellular Component | membrane | |
Cellular Component | viral envelope | |
Cellular Component | virion membrane | |
Biological Process | intracellular transport of virus |
Names & Taxonomy
Protein names
- Recommended nameEnvelope protein US9
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Peploviricota > Herviviricetes > Herpesvirales > Orthoherpesviridae > Alphaherpesvirinae > Simplexvirus > Simplexvirus humanalpha1 > Human herpesvirus 1
- Virus hosts
Accessions
- Primary accessionP06481
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Virion membrane ; Single-pass type II membrane protein
Host Golgi apparatus membrane ; Single-pass type II membrane protein
Host smooth endoplasmic reticulum membrane ; Single-pass type II membrane protein
Host cell membrane ; Single-pass type II membrane protein
Note: During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN), maybe through an interaction with PACS-1 sorting protein (Potential).
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-67 | Intravirion | ||||
Sequence: MTSRLSDPNSSARSDMSVPLYPTASPVSVEAYYSESEDEAANDFLVRMGRQQSVLRRRRRRTRCVGM | ||||||
Transmembrane | 68-88 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: VIACLLVAVLSGGFGALLMWL | ||||||
Topological domain | 89-90 | Virion surface | ||||
Sequence: LR |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 29 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: V → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000116132 | 1-90 | Envelope protein US9 | |||
Sequence: MTSRLSDPNSSARSDMSVPLYPTASPVSVEAYYSESEDEAANDFLVRMGRQQSVLRRRRRRTRCVGMVIACLLVAVLSGGFGALLMWLLR | ||||||
Modified residue | 34 | Phosphoserine; by host CK2 | ||||
Sequence: S | ||||||
Modified residue | 36 | Phosphoserine; by host CK2 | ||||
Sequence: S |
Post-translational modification
Phosphorylated on serines within the acidic cluster, possibly by host CK2. Phosphorylation determines whether endocytosed viral US9 traffics to the trans-Golgi network or recycles to the cell membrane.
Keywords
- PTM
Family & Domains
Features
Showing features for motif, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 21-24 | Internalization motif | ||||
Sequence: YPTA | ||||||
Region | 30-39 | Acidic | ||||
Sequence: EAYYSESEDE |
Sequence similarities
Belongs to the alphaherpesvirinae envelope protein US9 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length90
- Mass (Da)10,027
- Last updated1988-01-01 v1
- ChecksumF4D4DC2608BB38F7
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L00036 EMBL· GenBank· DDBJ | AAA96679.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X14112 EMBL· GenBank· DDBJ | CAA32274.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X02138 EMBL· GenBank· DDBJ | CAA26063.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ889502 EMBL· GenBank· DDBJ | ABI63528.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FJ593289 EMBL· GenBank· DDBJ | ACM62299.1 EMBL· GenBank· DDBJ | Genomic DNA |