P05179 · CP2C7_RAT
- ProteinCytochrome P450 2C7
- GeneCyp2c7
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids490 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Catalytic activity
- an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H+ + H2O + oxidized [NADPH--hemoprotein reductase]
Cofactor
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | intracellular membrane-bounded organelle | |
Molecular Function | arachidonic acid epoxygenase activity | |
Molecular Function | aromatase activity | |
Molecular Function | heme binding | |
Molecular Function | iron ion binding | |
Molecular Function | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen | |
Biological Process | epoxygenase P450 pathway | |
Biological Process | response to ethanol | |
Biological Process | response to lipopolysaccharide | |
Biological Process | response to nutrient | |
Biological Process | response to organic cyclic compound | |
Biological Process | response to peptide hormone | |
Biological Process | response to retinoic acid | |
Biological Process | response to xenobiotic stimulus | |
Biological Process | xenobiotic metabolic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCytochrome P450 2C7
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionP05179
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Peripheral membrane protein
Microsome membrane ; Peripheral membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000051698 | 1-490 | Cytochrome P450 2C7 | |||
Sequence: MDLVTFLVLTLSSLILLSLWRQSSRRRKLPPGPTPLPIIGNFLQIDVKNISQSLTKFSKTYGPVFTLYLGSQPTVILHGYEAIKEALIDNGEKFSGRGSYPMNENVTKGFGIVFSNGNRWKEMRRFTIMNFRNLGIGKRNIEDRVQEEAQCLVEELRKTKGSPCDPSLILNCAPCNVICSITFQNHFDYKDKEMLTFMEKVNENLKIMSSPWMQVCNSFPSLIDYFPGTHHKIAKNINYMKSYLLKKIEEHQESLDVTNPRDFVDYYLIKQKQANNIEQSEYSHENLTCSIMDLIGAGTETMSTTLRYALLLLMKYPHVTAKVQEEIDRVIGRHRSPCMQDRKHMPYTDAMIHEVQRFINFVPTNLPHAVTCDIKFRNYLIPKGTKVLTSLTSVLHDSKEFPNPEMFDPGHFLDENGNFKKSDYFLPFSAGKRACVGEGLARMQLFLFLTTILQNFNLKSLVHPKDIDTMPVLNGFASLPPTYQLCFIPS | ||||||
Modified residue | 144 | Dimethylated arginine | ||||
Sequence: R |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Induction
By growth hormone. P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.
Structure
Sequence
- Sequence statusComplete
- Length490
- Mass (Da)56,187
- Last updated1989-10-01 v2
- Checksum0FBACF3E9C6ABAA5
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
D4ABM1 | D4ABM1_RAT | Cyp2c7 | 513 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 28 | in Ref. 5; AAA41058 | ||||
Sequence: K → E | ||||||
Sequence conflict | 57-65 | in Ref. 2; CAA31108 | ||||
Sequence: FSKTYGPVF → VSIVGDPVI | ||||||
Sequence conflict | 87 | in Ref. 6; no nucleotide entry | ||||
Sequence: L → V | ||||||
Sequence conflict | 103 | in Ref. 5; AAA41058 and 6; no nucleotide entry | ||||
Sequence: N → I | ||||||
Sequence conflict | 130 | in Ref. 6; no nucleotide entry | ||||
Sequence: N → T | ||||||
Sequence conflict | 279 | in Ref. 5; AAA41058 | ||||
Sequence: Q → H | ||||||
Sequence conflict | 351-352 | in Ref. 5; AAA41058 | ||||
Sequence: MI → HD | ||||||
Sequence conflict | 383-385 | in Ref. 6; no nucleotide entry | ||||
Sequence: KGT → RRA | ||||||
Sequence conflict | 408-411 | in Ref. 6; no nucleotide entry | ||||
Sequence: DPGH → VPWP | ||||||
Sequence conflict | 471 | in Ref. 6; no nucleotide entry | ||||
Sequence: P → A |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M18335 EMBL· GenBank· DDBJ | AAA41036.1 EMBL· GenBank· DDBJ | mRNA | ||
X12595 EMBL· GenBank· DDBJ | CAA31108.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M31031 EMBL· GenBank· DDBJ | AAA41058.1 EMBL· GenBank· DDBJ | mRNA |