P05099 · MATN1_CHICK
- ProteinCartilage matrix protein
- GeneMATN1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids493 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Cartilage matrix protein is a major component of the extracellular matrix of non-articular cartilage. It binds to collagen.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | collagen-containing extracellular matrix | |
Cellular Component | extracellular region | |
Molecular Function | calcium ion binding |
Names & Taxonomy
Protein names
- Recommended nameCartilage matrix protein
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Galloanserae > Galliformes > Phasianidae > Phasianinae > Gallus
Accessions
- Primary accessionP05099
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MDGIFCALPLSLLLLLQSCGVWG | ||||||
Chain | PRO_0000007494 | 24-493 | Cartilage matrix protein | |||
Sequence: APPQPRGTLCRTKPTDLVFIIDSSRSVRPQEFEKVKVFLSRVIEGLDVGPNSTRVGVINYASAVKNEFSLKTHQTKAELLQAVQRIEPLSTGTMTGLAIQFAISRAFSDTEGARLRSPNINKVAIVVTDGRPQDGVQDVSARARQAGIEIFAIGVGRVDMHTLRQIASEPLDDHVDYVESYSVIEKLTHKFQEAFCVVSDLCATGDHDCEQICISTPGSYKCACKEGFTLNNDGKTCSACSGGSGSALDLVFLIDGSKSVRPENFELVKKFINQIVESLEVSEKQAQVGLVQYSSSVRQEFPLGQFKNKKDIKAAVKKMAYMEKGTMTGQALKYLVDSSFSIANGARPGVPKVGIVFTDGRSQDYITDAAKKAKDLGFRMFAVGVGNAVEDELREIASEPVAEHYFYTADFRTISNIGKKLQMKICVEEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKII | ||||||
Disulfide bond | 33↔219 | |||||
Sequence: CRTKPTDLVFIIDSSRSVRPQEFEKVKVFLSRVIEGLDVGPNSTRVGVINYASAVKNEFSLKTHQTKAELLQAVQRIEPLSTGTMTGLAIQFAISRAFSDTEGARLRSPNINKVAIVVTDGRPQDGVQDVSARARQAGIEIFAIGVGRVDMHTLRQIASEPLDDHVDYVESYSVIEKLTHKFQEAFC | ||||||
Glycosylation | 74 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 225↔236 | |||||
Sequence: CATGDHDCEQIC | ||||||
Disulfide bond | 232↔245 | |||||
Sequence: CEQICISTPGSYKC | ||||||
Disulfide bond | 247↔260 | |||||
Sequence: CKEGFTLNNDGKTC | ||||||
Disulfide bond | 263↔449 | |||||
Sequence: CSGGSGSALDLVFLIDGSKSVRPENFELVKKFINQIVESLEVSEKQAQVGLVQYSSSVRQEFPLGQFKNKKDIKAAVKKMAYMEKGTMTGQALKYLVDSSFSIANGARPGVPKVGIVFTDGRSQDYITDAAKKAKDLGFRMFAVGVGNAVEDELREIASEPVAEHYFYTADFRTISNIGKKLQMKIC |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Structure
Family & Domains
Features
Showing features for domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 24-220 | VWFA 1 | ||||
Sequence: APPQPRGTLCRTKPTDLVFIIDSSRSVRPQEFEKVKVFLSRVIEGLDVGPNSTRVGVINYASAVKNEFSLKTHQTKAELLQAVQRIEPLSTGTMTGLAIQFAISRAFSDTEGARLRSPNINKVAIVVTDGRPQDGVQDVSARARQAGIEIFAIGVGRVDMHTLRQIASEPLDDHVDYVESYSVIEKLTHKFQEAFCV | ||||||
Domain | 221-261 | EGF-like | ||||
Sequence: VSDLCATGDHDCEQICISTPGSYKCACKEGFTLNNDGKTCS | ||||||
Domain | 262-450 | VWFA 2 | ||||
Sequence: ACSGGSGSALDLVFLIDGSKSVRPENFELVKKFINQIVESLEVSEKQAQVGLVQYSSSVRQEFPLGQFKNKKDIKAAVKKMAYMEKGTMTGQALKYLVDSSFSIANGARPGVPKVGIVFTDGRSQDYITDAAKKAKDLGFRMFAVGVGNAVEDELREIASEPVAEHYFYTADFRTISNIGKKLQMKICV | ||||||
Coiled coil | 462-492 | |||||
Sequence: KFQTKVEELINTLQQKLEAVAKRIEALENKI |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length493
- Mass (Da)54,034
- Last updated1991-05-01 v2
- ChecksumE4D3DACFAB2B96A4
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X12353 EMBL· GenBank· DDBJ | CAA30915.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X12346 EMBL· GenBank· DDBJ | CAA30915.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X12347 EMBL· GenBank· DDBJ | CAA30915.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X12348 EMBL· GenBank· DDBJ | CAA30915.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X12349 EMBL· GenBank· DDBJ | CAA30915.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X12350 EMBL· GenBank· DDBJ | CAA30915.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X12351 EMBL· GenBank· DDBJ | CAA30915.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X12352 EMBL· GenBank· DDBJ | CAA30915.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M14792 EMBL· GenBank· DDBJ | AAA48695.1 EMBL· GenBank· DDBJ | mRNA | ||
M97497 EMBL· GenBank· DDBJ | AAC18872.1 EMBL· GenBank· DDBJ | Genomic DNA |