P05017 · IGF1_MOUSE
- ProteinInsulin-like growth factor I
- GeneIgf1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids153 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation (By similarity).
Ca2+-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb (PubMed:21496647).
Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (By similarity).
As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM (By similarity).
Ca2+-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb (PubMed:21496647).
Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (By similarity).
As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInsulin-like growth factor I
- Short namesIGF-I
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP05017
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for propeptide, signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Propeptide | PRO_0000015666 | ?-48 | ||||
Sequence: MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTA | ||||||
Signal | 1-? | |||||
Chain | PRO_0000015667 | 49-118 | Insulin-like growth factor I | |||
Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA | ||||||
Disulfide bond | 54↔96 | |||||
Sequence: CGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECC | ||||||
Disulfide bond | 66↔109 | |||||
Sequence: CGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYC | ||||||
Disulfide bond | 95↔100 | |||||
Sequence: CCFRSC | ||||||
Propeptide | PRO_0000015668 | 119-153 | E peptide | |||
Sequence: RSIRAQRHTDMPKTQKEVHLKNTSRGSAGNKTYRM |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Induction
Expression in the bone oscillates in a circadian manner and its expression is negatively regulated by CCRN4L/NOC.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 49-77 | B | ||||
Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPT | ||||||
Region | 78-89 | C | ||||
Sequence: GYGSSIRRAPQT | ||||||
Region | 90-110 | A | ||||
Sequence: GIVDECCFRSCDLRRLEMYCA | ||||||
Region | 111-118 | D | ||||
Sequence: PLKPTKAA | ||||||
Region | 120-153 | Disordered | ||||
Sequence: SIRAQRHTDMPKTQKEVHLKNTSRGSAGNKTYRM | ||||||
Compositional bias | 121-138 | Basic and acidic residues | ||||
Sequence: IRAQRHTDMPKTQKEVHL | ||||||
Compositional bias | 139-153 | Polar residues | ||||
Sequence: KNTSRGSAGNKTYRM |
Sequence similarities
Belongs to the insulin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
P05017-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameIGF-IA
- Length153
- Mass (Da)17,093
- Last updated2004-12-07 v2
- Checksum967596AEAC0CA387
P05017-2
- NameIGF-IB
- Differences from canonical
- 135-153: EVHLKNTSRGSAGNKTYRM → SPSLSTNKKTKLQRRRKGSTFEE
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 121-138 | Basic and acidic residues | ||||
Sequence: IRAQRHTDMPKTQKEVHL | ||||||
Alternative sequence | VSP_012165 | 135-153 | in isoform IGF-IB | |||
Sequence: EVHLKNTSRGSAGNKTYRM → SPSLSTNKKTKLQRRRKGSTFEE | ||||||
Compositional bias | 139-153 | Polar residues | ||||
Sequence: KNTSRGSAGNKTYRM |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK081019 EMBL· GenBank· DDBJ | BAC38117.1 EMBL· GenBank· DDBJ | mRNA | ||
BC012409 EMBL· GenBank· DDBJ | AAH12409.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
X04480 EMBL· GenBank· DDBJ | CAA28168.1 EMBL· GenBank· DDBJ | mRNA | ||
X04482 EMBL· GenBank· DDBJ | CAA28170.1 EMBL· GenBank· DDBJ | mRNA | ||
M28139 EMBL· GenBank· DDBJ | AAA74553.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M14983 EMBL· GenBank· DDBJ | AAA37925.1 EMBL· GenBank· DDBJ | Genomic DNA |