P04839 · CY24B_HUMAN
- ProteinCytochrome b-245 heavy chain
- GeneCYBB
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids570 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H+ currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.
Cofactor
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 101 | Fe (UniProtKB | ChEBI) of heme (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: H | ||||||
Binding site | 115 | Fe (UniProtKB | ChEBI) of heme (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: H | ||||||
Binding site | 209 | Fe (UniProtKB | ChEBI) of heme (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: H | ||||||
Binding site | 222 | Fe (UniProtKB | ChEBI) of heme (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: H | ||||||
Binding site | 338-344 | FAD (UniProtKB | ChEBI) | ||||
Sequence: HPFTLTS |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCytochrome b-245 heavy chain
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP04839
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Note: As unassembled monomer may localize to the endoplasmic reticulum.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 2-8 | Cytoplasmic | ||||
Sequence: GNWAVNE | ||||||
Transmembrane | 9-29 | Helical | ||||
Sequence: GLSIFVILVWLGLNVFLFVWY | ||||||
Topological domain | 30-48 | Extracellular | ||||
Sequence: YRVYDIPPKFFYTRKLLGS | ||||||
Transmembrane | 49-69 | Helical | ||||
Sequence: ALALARAPAACLNFNCMLILL | ||||||
Topological domain | 70-102 | Cytoplasmic | ||||
Sequence: PVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHK | ||||||
Transmembrane | 103-123 | Helical | ||||
Sequence: MVAWMIALHSAIHTIAHLFNV | ||||||
Topological domain | 124-169 | Extracellular | ||||
Sequence: EWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYL | ||||||
Transmembrane | 170-190 | Helical | ||||
Sequence: AVTLLAGITGVVITLCLILII | ||||||
Topological domain | 191-200 | Cytoplasmic | ||||
Sequence: TSSTKTIRRS | ||||||
Transmembrane | 201-221 | Helical | ||||
Sequence: YFEVFWYTHHLFVIFFIGLAI | ||||||
Topological domain | 222-261 | Extracellular | ||||
Sequence: HGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQ | ||||||
Transmembrane | 262-282 | Helical | ||||
Sequence: FAGNPPMTWKWIVGPMFLYLC | ||||||
Topological domain | 283-570 | Cytoplasmic | ||||
Sequence: ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Granulomatous disease, chronic, X-linked (CGDX)
- Note
- DescriptionA form of chronic granulomatous disease, a primary immunodeficiency characterized by severe recurrent bacterial and fungal infections, along with manifestations of chronic granulomatous inflammation. It results from an impaired ability of phagocytes to mount a burst of reactive oxygen species in response to pathogens.
- See alsoMIM:306400
Natural variants in CGDX
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_047264 | 18 | W>C | in CGDX | |
VAR_007873 | 20 | G>R | in CGDX; dbSNP:rs151344455 | |
VAR_025613 | 41 | Y>D | in CGDX; dbSNP:rs151344453 | |
VAR_025614 | 54 | R>M | in CGDX; dbSNP:rs151344479 | |
VAR_007874 | 54 | R>S | in CGDX; dbSNP:rs151344456 | |
VAR_047265 | 54-55 | missing | in CGDX | |
VAR_025615 | 55 | A>D | in CGDX; dbSNP:rs151344480 | |
VAR_008845 | 57 | A>E | in CGDX; dbSNP:rs151344481 | |
VAR_007875 | 59 | C>R | in CGDX; dbSNP:rs151344457 | |
VAR_047266 | 59 | C>W | in CGDX; dbSNP:rs151344488 | |
VAR_002432 | 101 | H>R | in CGDX; dbSNP:rs137854591 | |
VAR_007876 | 101 | H>Y | in CGDX; dbSNP:rs137854594 | |
VAR_007877 | 119 | H>R | in CGDX; dbSNP:rs151344458 | |
VAR_002433 | 156 | A>T | in CGDX; dbSNP:rs137854590 | |
VAR_047267 | 179 | G>R | in CGDX; dbSNP:rs151344491 | |
VAR_047268 | 193 | S>F | in CGDX; dbSNP:rs151344493 | |
VAR_047269 | 205 | F>I | in CGDX; dbSNP:rs151344496 | |
VAR_007878 | 209 | H>Q | in CGDX; dbSNP:rs151344459 | |
VAR_025616 | 209 | H>R | in CGDX; dbSNP:rs151344482 | |
VAR_002434 | 209 | H>Y | in CGDX; dbSNP:rs137854587 | |
VAR_007879 | 215 | missing | in CGDX | |
VAR_007880 | 222 | H>N | in CGDX; dbSNP:rs151344460 | |
VAR_007881 | 222 | H>R | in CGDX; dbSNP:rs151344462 | |
VAR_007882 | 222 | H>Y | in CGDX; dbSNP:rs151344460 | |
VAR_007883 | 223 | G>L | in CGDX; requires 2 nucleotide substitutions; dbSNP:rs151344463 and dbSNP:rs151344464 | |
VAR_025617 | 224 | A>G | in CGDX; dbSNP:rs151344483 | |
VAR_002435 | 225 | E>V | in CGDX; dbSNP:rs151344494 | |
VAR_007884 | 244 | C>R | in CGDX; dbSNP:rs151344465 | |
VAR_002436 | 244 | C>S | in CGDX; dbSNP:rs137854589 | |
VAR_002437 | 244 | C>Y | in CGDX; dbSNP:rs137854589 | |
VAR_047270 | 298-302 | missing | in CGDX | |
VAR_071861 | 299 | K>N | in CGDX | |
VAR_016880 | 303 | H>N | in CGDX; completely inhibits NADPH oxidase activity; NADPH oxidase assembly is abolished; dbSNP:rs137854595 | |
VAR_016881 | 304 | P>R | in CGDX; reduces NADPH oxidase activity to 4% of wild-type; translocation to the membrane of the phagosome is only attenuated; dbSNP:rs137854596 | |
VAR_047271 | 307 | T>P | in CGDX; dbSNP:rs151344489 | |
VAR_007885 | 309 | E>K | in CGDX; dbSNP:rs151344466 | |
VAR_047272 | 315 | missing | in CGDX; dbSNP:rs2146817067 | |
VAR_007886 | 322 | G>E | in CGDX; dbSNP:rs151344467 | |
VAR_007887 | 325 | I>F | in CGDX; dbSNP:rs151344468 | |
VAR_007888 | 333 | S>P | in CGDX; dbSNP:rs151344469 | |
VAR_071862 | 338 | H>D | in CGDX | |
VAR_025618 | 338 | H>Y | in CGDX; dbSNP:rs151344484 | |
VAR_002438 | 339 | P>H | in CGDX; dbSNP:rs151344470 | |
VAR_047273 | 342 | L>Q | in CGDX; dbSNP:rs151344495 | |
VAR_025619 | 344 | S>F | in CGDX; dbSNP:rs151344485 | |
VAR_007889 | 356 | R>P | in CGDX; dbSNP:rs151344471 | |
VAR_002439 | 389 | G>A | in CGDX; dbSNP:rs137854586 | |
VAR_025621 | 389 | G>E | in CGDX; dbSNP:rs137854586 | |
VAR_007890 | 405 | M>R | in CGDX; dbSNP:rs151344472 | |
VAR_007891 | 408 | G>E | in CGDX; dbSNP:rs151344474 | |
VAR_007892 | 408 | G>R | in CGDX; dbSNP:rs151344473 | |
VAR_078386 | 409 | A>G | in CGDX | |
VAR_071863 | 412 | G>E | in CGDX | |
VAR_002440 | 415 | P>H | in CGDX; dbSNP:rs137854585 | |
VAR_007893 | 415 | P>L | in CGDX; dbSNP:rs137854585 | |
VAR_025622 | 420 | L>P | in CGDX; dbSNP:rs151344486 | |
VAR_007894 | 422 | S>P | in CGDX; dbSNP:rs151344475 | |
VAR_007895 | 453 | W>R | in CGDX; dbSNP:rs151344476 | |
VAR_068012 | 488 | A>D | in CGDX | |
VAR_068013 | 500 | D>E | in CGDX | |
VAR_002441 | 500 | D>G | in CGDX; dbSNP:rs137854593 | |
VAR_047275 | 505 | L>R | in CGDX; dbSNP:rs151344490 | |
VAR_007896 | 516 | W>C | in CGDX; dbSNP:rs151344477 | |
VAR_025623 | 516 | W>R | in CGDX; dbSNP:rs151344487 | |
VAR_007897 | 534 | V>D | in CGDX; dbSNP:rs151344478 | |
VAR_007898 | 537 | C>R | in CGDX; dbSNP:rs151344454 | |
VAR_047276 | 546 | L>P | in CGDX; dbSNP:rs151344492 |
Immunodeficiency 34 (IMD34)
- Note
- DescriptionA form of Mendelian susceptibility to mycobacterial disease, a rare condition characterized by predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine, environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals.
- See alsoMIM:300645
Natural variants in IMD34
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_065365 | 178 | T>P | in IMD34; dbSNP:rs151344497 | |
VAR_065366 | 231 | Q>P | in IMD34; dbSNP:rs151344498 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_047264 | 18 | in CGDX | |||
Sequence: W → C | ||||||
Natural variant | VAR_007873 | 20 | in CGDX; dbSNP:rs151344455 | |||
Sequence: G → R | ||||||
Natural variant | VAR_025613 | 41 | in CGDX; dbSNP:rs151344453 | |||
Sequence: Y → D | ||||||
Natural variant | VAR_025614 | 54 | in CGDX; dbSNP:rs151344479 | |||
Sequence: R → M | ||||||
Natural variant | VAR_007874 | 54 | in CGDX; dbSNP:rs151344456 | |||
Sequence: R → S | ||||||
Natural variant | VAR_047265 | 54-55 | in CGDX | |||
Sequence: Missing | ||||||
Natural variant | VAR_025615 | 55 | in CGDX; dbSNP:rs151344480 | |||
Sequence: A → D | ||||||
Natural variant | VAR_008845 | 57 | in CGDX; dbSNP:rs151344481 | |||
Sequence: A → E | ||||||
Natural variant | VAR_007875 | 59 | in CGDX; dbSNP:rs151344457 | |||
Sequence: C → R | ||||||
Natural variant | VAR_047266 | 59 | in CGDX; dbSNP:rs151344488 | |||
Sequence: C → W | ||||||
Natural variant | VAR_002432 | 101 | in CGDX; dbSNP:rs137854591 | |||
Sequence: H → R | ||||||
Natural variant | VAR_007876 | 101 | in CGDX; dbSNP:rs137854594 | |||
Sequence: H → Y | ||||||
Natural variant | VAR_007877 | 119 | in CGDX; dbSNP:rs151344458 | |||
Sequence: H → R | ||||||
Natural variant | VAR_002433 | 156 | in CGDX; dbSNP:rs137854590 | |||
Sequence: A → T | ||||||
Natural variant | VAR_065365 | 178 | in IMD34; dbSNP:rs151344497 | |||
Sequence: T → P | ||||||
Natural variant | VAR_047267 | 179 | in CGDX; dbSNP:rs151344491 | |||
Sequence: G → R | ||||||
Natural variant | VAR_047268 | 193 | in CGDX; dbSNP:rs151344493 | |||
Sequence: S → F | ||||||
Natural variant | VAR_047269 | 205 | in CGDX; dbSNP:rs151344496 | |||
Sequence: F → I | ||||||
Natural variant | VAR_007878 | 209 | in CGDX; dbSNP:rs151344459 | |||
Sequence: H → Q | ||||||
Natural variant | VAR_025616 | 209 | in CGDX; dbSNP:rs151344482 | |||
Sequence: H → R | ||||||
Natural variant | VAR_002434 | 209 | in CGDX; dbSNP:rs137854587 | |||
Sequence: H → Y | ||||||
Natural variant | VAR_007879 | 215 | in CGDX | |||
Sequence: Missing | ||||||
Natural variant | VAR_007880 | 222 | in CGDX; dbSNP:rs151344460 | |||
Sequence: H → N | ||||||
Natural variant | VAR_007881 | 222 | in CGDX; dbSNP:rs151344462 | |||
Sequence: H → R | ||||||
Natural variant | VAR_007882 | 222 | in CGDX; dbSNP:rs151344460 | |||
Sequence: H → Y | ||||||
Natural variant | VAR_007883 | 223 | in CGDX; requires 2 nucleotide substitutions; dbSNP:rs151344463 and dbSNP:rs151344464 | |||
Sequence: G → L | ||||||
Natural variant | VAR_025617 | 224 | in CGDX; dbSNP:rs151344483 | |||
Sequence: A → G | ||||||
Natural variant | VAR_002435 | 225 | in CGDX; dbSNP:rs151344494 | |||
Sequence: E → V | ||||||
Natural variant | VAR_065366 | 231 | in IMD34; dbSNP:rs151344498 | |||
Sequence: Q → P | ||||||
Natural variant | VAR_007884 | 244 | in CGDX; dbSNP:rs151344465 | |||
Sequence: C → R | ||||||
Natural variant | VAR_002436 | 244 | in CGDX; dbSNP:rs137854589 | |||
Sequence: C → S | ||||||
Natural variant | VAR_002437 | 244 | in CGDX; dbSNP:rs137854589 | |||
Sequence: C → Y | ||||||
Natural variant | VAR_047270 | 298-302 | in CGDX | |||
Sequence: Missing | ||||||
Natural variant | VAR_071861 | 299 | in CGDX | |||
Sequence: K → N | ||||||
Natural variant | VAR_016880 | 303 | in CGDX; completely inhibits NADPH oxidase activity; NADPH oxidase assembly is abolished; dbSNP:rs137854595 | |||
Sequence: H → N | ||||||
Natural variant | VAR_016881 | 304 | in CGDX; reduces NADPH oxidase activity to 4% of wild-type; translocation to the membrane of the phagosome is only attenuated; dbSNP:rs137854596 | |||
Sequence: P → R | ||||||
Natural variant | VAR_047271 | 307 | in CGDX; dbSNP:rs151344489 | |||
Sequence: T → P | ||||||
Natural variant | VAR_007885 | 309 | in CGDX; dbSNP:rs151344466 | |||
Sequence: E → K | ||||||
Natural variant | VAR_047272 | 315 | in CGDX; dbSNP:rs2146817067 | |||
Sequence: Missing | ||||||
Natural variant | VAR_007886 | 322 | in CGDX; dbSNP:rs151344467 | |||
Sequence: G → E | ||||||
Natural variant | VAR_007887 | 325 | in CGDX; dbSNP:rs151344468 | |||
Sequence: I → F | ||||||
Natural variant | VAR_007888 | 333 | in CGDX; dbSNP:rs151344469 | |||
Sequence: S → P | ||||||
Natural variant | VAR_071862 | 338 | in CGDX | |||
Sequence: H → D | ||||||
Natural variant | VAR_025618 | 338 | in CGDX; dbSNP:rs151344484 | |||
Sequence: H → Y | ||||||
Natural variant | VAR_002438 | 339 | in CGDX; dbSNP:rs151344470 | |||
Sequence: P → H | ||||||
Natural variant | VAR_047273 | 342 | in CGDX; dbSNP:rs151344495 | |||
Sequence: L → Q | ||||||
Natural variant | VAR_025619 | 344 | in CGDX; dbSNP:rs151344485 | |||
Sequence: S → F | ||||||
Natural variant | VAR_007889 | 356 | in CGDX; dbSNP:rs151344471 | |||
Sequence: R → P | ||||||
Natural variant | VAR_025620 | 364 | in dbSNP:rs141756032 | |||
Sequence: G → R | ||||||
Natural variant | VAR_002439 | 389 | in CGDX; dbSNP:rs137854586 | |||
Sequence: G → A | ||||||
Natural variant | VAR_025621 | 389 | in CGDX; dbSNP:rs137854586 | |||
Sequence: G → E | ||||||
Natural variant | VAR_007890 | 405 | in CGDX; dbSNP:rs151344472 | |||
Sequence: M → R | ||||||
Natural variant | VAR_007891 | 408 | in CGDX; dbSNP:rs151344474 | |||
Sequence: G → E | ||||||
Natural variant | VAR_007892 | 408 | in CGDX; dbSNP:rs151344473 | |||
Sequence: G → R | ||||||
Natural variant | VAR_078386 | 409 | in CGDX | |||
Sequence: A → G | ||||||
Natural variant | VAR_071863 | 412 | in CGDX | |||
Sequence: G → E | ||||||
Natural variant | VAR_002440 | 415 | in CGDX; dbSNP:rs137854585 | |||
Sequence: P → H | ||||||
Natural variant | VAR_007893 | 415 | in CGDX; dbSNP:rs137854585 | |||
Sequence: P → L | ||||||
Natural variant | VAR_025622 | 420 | in CGDX; dbSNP:rs151344486 | |||
Sequence: L → P | ||||||
Natural variant | VAR_007894 | 422 | in CGDX; dbSNP:rs151344475 | |||
Sequence: S → P | ||||||
Natural variant | VAR_007895 | 453 | in CGDX; dbSNP:rs151344476 | |||
Sequence: W → R | ||||||
Natural variant | VAR_047274 | 472 | in dbSNP:rs13306300 | |||
Sequence: G → S | ||||||
Natural variant | VAR_068012 | 488 | in CGDX | |||
Sequence: A → D | ||||||
Natural variant | VAR_068013 | 500 | in CGDX | |||
Sequence: D → E | ||||||
Natural variant | VAR_002441 | 500 | in CGDX; dbSNP:rs137854593 | |||
Sequence: D → G | ||||||
Natural variant | VAR_047275 | 505 | in CGDX; dbSNP:rs151344490 | |||
Sequence: L → R | ||||||
Natural variant | VAR_007896 | 516 | in CGDX; dbSNP:rs151344477 | |||
Sequence: W → C | ||||||
Natural variant | VAR_025623 | 516 | in CGDX; dbSNP:rs151344487 | |||
Sequence: W → R | ||||||
Natural variant | VAR_025624 | 517 | in dbSNP:rs151344452 | |||
Sequence: D → E | ||||||
Natural variant | VAR_007897 | 534 | in CGDX; dbSNP:rs151344478 | |||
Sequence: V → D | ||||||
Natural variant | VAR_007898 | 537 | in CGDX; dbSNP:rs151344454 | |||
Sequence: C → R | ||||||
Natural variant | VAR_047276 | 546 | in CGDX; dbSNP:rs151344492 | |||
Sequence: L → P |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 537 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, chain, glycosylation, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Chain | PRO_0000210145 | 2-570 | Cytochrome b-245 heavy chain | |||
Sequence: GNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACLNFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF | ||||||
Glycosylation | 132 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 149 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Cross-link | 161 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Glycosylation | 240 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Cross-link | 255 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 294 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 299 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 306 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 328 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 334 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 381 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 506 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 567 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K |
Post-translational modification
Glycosylated.
Phosphorylated on Ser and Thr residues.
Undergoes 'Lys-48'-linked polyubiquitination, likely by RNF145, triggering endoplasmic reticulum-associated degradation.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected in neutrophils (at protein level).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Composed of a heavy chain (beta) and a light chain (alpha). Component of an NADPH oxidase complex composed of a heterodimer formed by the membrane proteins CYBA and CYBB and the cytosolic subunits NCF1, NCF2 and NCF4. Interacts with NCF1. Interacts with calprotectin (S100A8/9). Interacts with NRROS; the interaction is direct and impairs formation of a stable NADPH oxidase complex (PubMed:19028840, PubMed:3600769, PubMed:9224653).
Interacts with CYBC1; CYBC1 may act as a chaperone stabilizing Cytochrome b-245 heterodimer (PubMed:28351984).
Interacts with NCF2; the interaction is enhanced in the presence of GBP7 (By similarity).
The CYBA-CYBB complex interacts with GBP7 (By similarity).
Interacts with CYBC1; CYBC1 may act as a chaperone stabilizing Cytochrome b-245 heterodimer (PubMed:28351984).
Interacts with NCF2; the interaction is enhanced in the presence of GBP7 (By similarity).
The CYBA-CYBB complex interacts with GBP7 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P04839 | CYBC1 Q9BQA9 | 3 | EBI-6253630, EBI-2680384 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 54-286 | Ferric oxidoreductase | ||||
Sequence: RAPAACLNFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLV | ||||||
Domain | 287-397 | FAD-binding FR-type | ||||
Sequence: RFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASED |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length570
- Mass (Da)65,336
- Last updated2007-01-23 v2
- Checksum7E84051BD4000CE3
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8Q3WMA3 | A0A8Q3WMA3_HUMAN | CYBB | 114 | ||
A0A8Q3SIF1 | A0A8Q3SIF1_HUMAN | CYBB | 128 | ||
A0A8Q3SIJ1 | A0A8Q3SIJ1_HUMAN | CYBB | 538 |
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 14 | in Ref. 6 and 4 | ||||
Sequence: V → A |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X04011 EMBL· GenBank· DDBJ | CAA27635.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AF469769 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469757 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469758 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469759 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469760 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469761 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469762 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469763 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469764 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469765 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469766 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469767 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF469768 EMBL· GenBank· DDBJ | AAL76082.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ314869 EMBL· GenBank· DDBJ | ABC40728.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK289753 EMBL· GenBank· DDBJ | BAF82442.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471141 EMBL· GenBank· DDBJ | EAW59453.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC032720 EMBL· GenBank· DDBJ | AAH32720.1 EMBL· GenBank· DDBJ | mRNA | ||
X05895 EMBL· GenBank· DDBJ | CAA29327.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AB013904 EMBL· GenBank· DDBJ | BAA34183.1 EMBL· GenBank· DDBJ | Genomic DNA |