P04698 · ZEAZW_MAIZE
- Protein22 kDa alpha-zein 14
- GeneAZS22-14
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids267 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Zeins are major seed storage proteins.
Miscellaneous
The alpha zeins of 19 kDa and 22 kDa account for 70% of the total zein fraction. They are encoded by a large multigene family.
Structurally, 22K and 19K zeins are composed of nine adjacent, topologically antiparallel helices clustered within a distorted cylinder.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | nutrient reservoir activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended name22 kDa alpha-zein 14
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > PACMAD clade > Panicoideae > Andropogonodae > Andropogoneae > Tripsacinae > Zea
Accessions
- Primary accessionP04698
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MATKILSLLALLALFASATNA | ||||||
Chain | PRO_0000041628 | 22-267 | 22 kDa alpha-zein 14 | |||
Sequence: SIIPQCSLAPSSIIPQFLPPVTSMAFEHPAVQAYRLQQAIAASVLQQPIAQLQQQSLAHLTIQTIATQQQQQQFLPALSHLAMVNPVAYLQQQLLASNPLALANVVANQQQQQLQQFLPALSQLAMVNPAAYLQQQQLLSSSPLAVANAPTYLQQELLQQIVPALTQLAVANPVAYLQQLLPFNQLTMSNSVAYLQQRQQLLNPLAVANPLVAAFLQQQQLLPYNRFSLMNPVLSRQQPIVGGAIF |
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the zein family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length267
- Mass (Da)29,063
- Last updated1987-08-13 v1
- ChecksumCF52BDA594A29302
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 89 | in Ref. 2; ACG48717/ACG48492 | ||||
Sequence: Missing | ||||||
Sequence conflict | 94 | in Ref. 1; AAA33533 | ||||
Sequence: Missing |
Keywords
- Technical term