P04308 · ETF1_VACCW
- ProteinEarly transcription factor 70 kDa subunit
- GeneOPG118
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids637 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Acts with RNA polymerase to initiate transcription from early gene promoters. Is recruited by the RPO-associated protein of 94 kDa RAP94/OPG109 to form the early transcription complex, which also contains the core RNA polymerase. ETF heterodimer binds to early gene promoters.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | virion component | |
Molecular Function | ATP binding | |
Molecular Function | DNA binding | |
Molecular Function | helicase activity | |
Molecular Function | hydrolase activity |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEarly transcription factor 70 kDa subunit
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Varidnaviria > Bamfordvirae > Nucleocytoviricota > Pokkesviricetes > Chitovirales > Poxviridae > Chordopoxvirinae > Orthopoxvirus > Vaccinia virus
- Virus hosts
Accessions
- Primary accessionP04308
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: All the enzymes and other proteins required to synthesize early mRNAs are packaged within the virion core along with the DNA genome. This is necessary because viral early mRNAs are synthesized within minutes after virus entry into the cell and are extruded through pores in the core particle.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000099071 | 1-637 | Early transcription factor 70 kDa subunit | |||
Sequence: MNTGIIDLFDNHVDSIPTILPHQLATLDYLVRTIIDENRSVLLFHIMGSGKTIIALLFALVASRFKKVYILVPNINILKIFNYNMGVAMNLFNDEFIAENIFIHSTTSFYSLNYNDNVINYNGLSRYNNSIFIVDEAHNIFGNNTGELMTVIKNKNKIPFLLLSGSPITNTPNTLGHIIDLMSEETIDFGEIISRGKKVIQTLLNERGVNVLKDLLKGRISYYEMPDKDLPTIRYHGRKFLDTRVVYCHMSKLQERDYMITRRQLCYHEMFDKNMYNVSMAVLGQLNLMNNLDTLFQEQDKELYPNLKINNGVLYGEELVTLNISSKFKYFINRIQTLNGKHFIYFSNSTYGGLVIKYIMLSNGYSEYNGSQGTNPHMINGKPKTFAIVTSKMKSSLEDLLDVYNSPENDDGSQLMFLFSSNIMSESYTLKEVRHIWFMTIPDTFSQYNQILGRSIRKFSYADISEPVNVYLLAAVYSDFNDEVTSLNDYTQDELINVLPFDIKKLLYLKFKTKETNRIYSILQEMSETYSLPPHPSIVKVLLGELVRQFFYNNSRIKYNDSKLLKMVTSVIKNKEDARNYIDDIVNGHFFVSNKVFDKSLLYKYENDIITVPFRLSYEPFVWGVNFRKEYNVVSSP |
Expression
Keywords
- Developmental stage
Interaction
Subunit
Heterodimer of a 70 kDa and a 82 kDa subunit. Part of the early transcription complex composed of ETF, RAP94/OPG109, and the DNA-directed RNA polymerase.
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 32-185 | Helicase ATP-binding | ||||
Sequence: RTIIDENRSVLLFHIMGSGKTIIALLFALVASRFKKVYILVPNINILKIFNYNMGVAMNLFNDEFIAENIFIHSTTSFYSLNYNDNVINYNGLSRYNNSIFIVDEAHNIFGNNTGELMTVIKNKNKIPFLLLSGSPITNTPNTLGHIIDLMSEE | ||||||
Motif | 135-138 | DEXH box | ||||
Sequence: DEAH | ||||||
Domain | 327-507 | Helicase C-terminal | ||||
Sequence: KFKYFINRIQTLNGKHFIYFSNSTYGGLVIKYIMLSNGYSEYNGSQGTNPHMINGKPKTFAIVTSKMKSSLEDLLDVYNSPENDDGSQLMFLFSSNIMSESYTLKEVRHIWFMTIPDTFSQYNQILGRSIRKFSYADISEPVNVYLLAAVYSDFNDEVTSLNDYTQDELINVLPFDIKKLL |
Sequence similarities
Belongs to the helicase family. VETF subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length637
- Mass (Da)73,831
- Last updated1987-03-20 v1
- ChecksumC6F172F9E68EDD3D
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M15058 EMBL· GenBank· DDBJ | AAA48262.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY243312 EMBL· GenBank· DDBJ | AAO89390.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M16021 EMBL· GenBank· DDBJ | AAA69630.1 EMBL· GenBank· DDBJ | Genomic DNA |