P04114 · APOB_HUMAN
- ProteinApolipoprotein B-100
- GeneAPOB
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids4563 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameApolipoprotein B-100
- Short namesApo B-100
- Cleaved into 1 chains
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP04114
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Hypobetalipoproteinemia, familial, 1 (FHBL1)
- Note
- DescriptionA disorder of lipid metabolism characterized by less than 5th percentile age- and sex-specific levels of low density lipoproteins, and dietary fat malabsorption. Clinical presentation may vary from no symptoms to severe gastrointestinal and neurological dysfunction similar to abetalipoproteinemia.
- See alsoMIM:615558
Natural variants in FHBL1
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_022610 | 490 | R>W | in FHBL1; reduced protein secretion; dbSNP:rs771541567 | |
VAR_076539 | 952 | V>L | in FHBL1; uncertain significance; does not affect interaction with MTTP |
Hypercholesterolemia, familial, 2 (FHCL2)
- Note
- DescriptionA form of hypercholesterolemia, a disorder of lipoprotein metabolism characterized by elevated serum low-density lipoprotein (LDL) cholesterol levels, which result in excess deposition of cholesterol in tissues and leads to xanthelasma, xanthomas, accelerated atherosclerosis and increased risk of premature coronary heart disease. FHCL2 inheritance is autosomal dominant.
- See alsoMIM:144010
Natural variants in FHCL2
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_005025 | 3527 | R>Q | in FHCL2; dbSNP:rs5742904 | |
VAR_005026 | 3558 | R>C | in FHCL2; dbSNP:rs12713559 |
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_067277 | 12-14 | ||||
Sequence: Missing | ||||||
Natural variant | VAR_016184 | 98 | influences plasma concentrations of low density lipoprotein cholesterol; dbSNP:rs1367117 | |||
Sequence: T → I | ||||||
Natural variant | VAR_022036 | 103 | in dbSNP:rs9282603 | |||
Sequence: Y → H | ||||||
Natural variant | VAR_022037 | 145 | in dbSNP:rs6752026 | |||
Sequence: P → S | ||||||
Natural variant | VAR_056737 | 194 | in dbSNP:rs13306198 | |||
Sequence: T → M | ||||||
Natural variant | VAR_076538 | 251 | does not affect plasma lipid levels; dbSNP:rs61741625 | |||
Sequence: A → T | ||||||
Natural variant | VAR_019827 | 273 | ||||
Sequence: K → N | ||||||
Natural variant | VAR_029341 | 408 | in dbSNP:rs12714225 | |||
Sequence: I → T | ||||||
Mutagenesis | 483 | Impairs protein secretion. | ||||
Sequence: D → N | ||||||
Mutagenesis | 483 | Does not affect protein secretion. | ||||
Sequence: D → Q | ||||||
Natural variant | VAR_022610 | 490 | in FHBL1; reduced protein secretion; dbSNP:rs771541567 | |||
Sequence: R → W | ||||||
Mutagenesis | 490 | Impairs protein secretion. | ||||
Sequence: R → A | ||||||
Mutagenesis | 490 | Does not affect protein secretion. | ||||
Sequence: R → K | ||||||
Natural variant | VAR_020135 | 554 | in dbSNP:rs12714214 | |||
Sequence: P → L | ||||||
Natural variant | VAR_019828 | 618 | in dbSNP:rs679899 | |||
Sequence: A → V | ||||||
Natural variant | VAR_020136 | 730 | in dbSNP:rs12691202 | |||
Sequence: V → I | ||||||
Natural variant | VAR_016185 | 733 | in dbSNP:rs1800476 | |||
Sequence: V → I | ||||||
Natural variant | VAR_020137 | 741 | in dbSNP:rs12714192 | |||
Sequence: T → N | ||||||
Natural variant | VAR_029342 | 877 | in dbSNP:rs12714097 | |||
Sequence: P → L | ||||||
Natural variant | VAR_076539 | 952 | in FHBL1; uncertain significance; does not affect interaction with MTTP | |||
Sequence: V → L | ||||||
Natural variant | VAR_056738 | 955 | in dbSNP:rs13306206 | |||
Sequence: P → S | ||||||
Natural variant | VAR_029343 | 1086 | in dbSNP:rs12720801 | |||
Sequence: G → S | ||||||
Natural variant | VAR_029344 | 1113 | in dbSNP:rs12713844 | |||
Sequence: D → H | ||||||
Natural variant | VAR_022611 | 1128 | in dbSNP:rs12713843 | |||
Sequence: R → H | ||||||
Natural variant | VAR_019829 | 1218 | in dbSNP:rs1041956 | |||
Sequence: Q → E | ||||||
Natural variant | VAR_029345 | 1388 | in dbSNP:rs13306187 | |||
Sequence: R → H | ||||||
Natural variant | VAR_061558 | 1422 | in dbSNP:rs568413 | |||
Sequence: C → Y | ||||||
Natural variant | VAR_005016 | 1437 | in dbSNP:rs1801697 | |||
Sequence: F → L | ||||||
Natural variant | VAR_067278 | 1613 | in dbSNP:rs61742247 | |||
Sequence: S → T | ||||||
Natural variant | VAR_068911 | 1670 | in dbSNP:rs773681906 | |||
Sequence: E → D | ||||||
Natural variant | VAR_005017 | 1914 | in dbSNP:rs1801699 | |||
Sequence: N → S | ||||||
Natural variant | VAR_005018 | 1923 | in dbSNP:rs533617 | |||
Sequence: H → R | ||||||
Natural variant | VAR_068912 | 2037 | ||||
Sequence: I → N | ||||||
Natural variant | VAR_019830 | 2092 | in dbSNP:rs1041960 | |||
Sequence: L → V | ||||||
Natural variant | VAR_029346 | 2299 | in dbSNP:rs12713681 | |||
Sequence: D → H | ||||||
Natural variant | VAR_059582 | 2313 | in dbSNP:rs584542 | |||
Sequence: I → V | ||||||
Natural variant | VAR_019831 | 2365 | in dbSNP:rs1041971 | |||
Sequence: A → T | ||||||
Natural variant | VAR_020138 | 2456 | in dbSNP:rs12713675 | |||
Sequence: A → D | ||||||
Natural variant | VAR_035795 | 2564 | in a colorectal cancer sample; somatic mutation; confirmed at protein level | |||
Sequence: F → C | ||||||
Natural variant | VAR_005019 | 2566 | in dbSNP:rs1801696 | |||
Sequence: E → K | ||||||
Natural variant | VAR_019832 | 2680 | in dbSNP:rs1042013 | |||
Sequence: L → Q | ||||||
Natural variant | VAR_005020 | 2739 | in dbSNP:rs676210 | |||
Sequence: P → L | ||||||
Natural variant | VAR_022038 | 2785 | in dbSNP:rs2163204 | |||
Sequence: N → H | ||||||
Natural variant | VAR_005021 | 3121 | in dbSNP:rs1801694 | |||
Sequence: A → T | ||||||
Natural variant | VAR_029347 | 3182 | in dbSNP:rs12720848 | |||
Sequence: H → N | ||||||
Natural variant | VAR_029348 | 3279 | in dbSNP:rs12720854 | |||
Sequence: S → G | ||||||
Natural variant | VAR_020139 | 3294 | in dbSNP:rs12720855 | |||
Sequence: S → P | ||||||
Natural variant | VAR_005022 | 3319 | in dbSNP:rs1042021 | |||
Sequence: D → H | ||||||
Natural variant | VAR_005023 | 3427 | in dbSNP:rs1042022 | |||
Sequence: T → K | ||||||
Natural variant | VAR_005024 | 3432 | in dbSNP:rs1042023 | |||
Sequence: Q → E | ||||||
Natural variant | VAR_005025 | 3527 | in FHCL2; dbSNP:rs5742904 | |||
Sequence: R → Q | ||||||
Natural variant | VAR_005026 | 3558 | in FHCL2; dbSNP:rs12713559 | |||
Sequence: R → C | ||||||
Natural variant | VAR_016186 | 3638 | in dbSNP:rs1801701 | |||
Sequence: R → Q | ||||||
Natural variant | VAR_019833 | 3732 | in dbSNP:rs1042025 | |||
Sequence: I → T | ||||||
Natural variant | VAR_029349 | 3801 | in dbSNP:rs12713540 | |||
Sequence: S → T | ||||||
Natural variant | VAR_067279 | 3835 | in dbSNP:rs776119459 | |||
Sequence: I → L | ||||||
Natural variant | VAR_005027 | 3921 | in dbSNP:rs72654409 | |||
Sequence: V → I | ||||||
Natural variant | VAR_005028 | 3945 | in dbSNP:rs1801698 | |||
Sequence: T → A | ||||||
Natural variant | VAR_019834 | 3949 | in dbSNP:rs1042027 | |||
Sequence: F → L | ||||||
Natural variant | VAR_019835 | 3964 | in dbSNP:rs1126468 | |||
Sequence: Y → F | ||||||
Natural variant | VAR_005029 | 4128 | in dbSNP:rs1801703 | |||
Sequence: V → M | ||||||
Natural variant | VAR_016187 | 4181 | in dbSNP:rs1042031 | |||
Sequence: E → K | ||||||
Natural variant | VAR_016188 | 4270 | in dbSNP:rs1801702 | |||
Sequence: R → T | ||||||
Natural variant | VAR_067280 | 4314 | in dbSNP:rs72654423 | |||
Sequence: I → V | ||||||
Natural variant | VAR_005030 | 4338 | in dbSNP:rs1042034 | |||
Sequence: S → N | ||||||
Natural variant | VAR_029350 | 4394 | in dbSNP:rs12720843 | |||
Sequence: V → A | ||||||
Natural variant | VAR_005031 | 4481 | in dbSNP:rs1801695 | |||
Sequence: A → T | ||||||
Natural variant | VAR_067281 | 4482 | in dbSNP:rs142702699 | |||
Sequence: I → V | ||||||
Natural variant | VAR_020140 | 4484 | in dbSNP:rs12713450 | |||
Sequence: T → M |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 6,350 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond, lipidation, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Signal | 1-27 | UniProt | |||||
Sequence: MDPPRPALLALLALPALLLLLLAGARA | |||||||
Chain | PRO_0000020751 | 28-2179 | UniProt | Apolipoprotein B-48 | |||
Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFGEGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTGDEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFPDSVNKALYWVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSVEKLIKDLKSKEVPEARAYLRILGEELGFASLHDLQLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQISSSGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQMNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPLIENRQSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGEIEQYSVSATYELQREDRALVDTLKFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPDFDVDLGTILRVNDESTEGKTSYRLTLDIQNKKITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAHWSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDYPKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQTLQDHLNSLKEFNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPLPFGGKSSRDLKMLETVRTPALHFKSVGFHLPSREFQVPTFTIPKLYQLQVPLLGVLDLSTNVYSNLYNWSASYSGGNTSTDHFSLRARYHMKADSVVDLLSYNVQGSGETTYDHKNTFTLSCDGSLRHKFLDSNIKFSHVEKLGNNPVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGTYGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDLQSGIIKNTASLKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRSEYQADYESLRFFSLLSGSLNSHGLELNADILGTDKINSGAHKATLRIGQDGISTSATTNLKCSLLVLENELNAELGLSGASMKLTTNGRFREHNAKFSLDGKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSNDMMGSYAEMKFDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSDLKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSASYKADTVAKVQGVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVMAPFTMTIDAHTNGNGKLALWGEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHHLVSRKSISAALEHKVSALLTPAEQTGTWKLKTQFNNNEYSQDLDAYNTKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDALEMRDAVEKPQEFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVLENVQRNLKHINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYRITENDIQIALDDAKINFNEKLSQLQTYMI | |||||||
Chain | PRO_0000020750 | 28-4563 | UniProt | Apolipoprotein B-100 | |||
Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFGEGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTGDEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFPDSVNKALYWVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSVEKLIKDLKSKEVPEARAYLRILGEELGFASLHDLQLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQISSSGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQMNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPLIENRQSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGEIEQYSVSATYELQREDRALVDTLKFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPDFDVDLGTILRVNDESTEGKTSYRLTLDIQNKKITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAHWSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDYPKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQTLQDHLNSLKEFNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPLPFGGKSSRDLKMLETVRTPALHFKSVGFHLPSREFQVPTFTIPKLYQLQVPLLGVLDLSTNVYSNLYNWSASYSGGNTSTDHFSLRARYHMKADSVVDLLSYNVQGSGETTYDHKNTFTLSCDGSLRHKFLDSNIKFSHVEKLGNNPVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGTYGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDLQSGIIKNTASLKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRSEYQADYESLRFFSLLSGSLNSHGLELNADILGTDKINSGAHKATLRIGQDGISTSATTNLKCSLLVLENELNAELGLSGASMKLTTNGRFREHNAKFSLDGKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSNDMMGSYAEMKFDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSDLKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSASYKADTVAKVQGVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVMAPFTMTIDAHTNGNGKLALWGEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHHLVSRKSISAALEHKVSALLTPAEQTGTWKLKTQFNNNEYSQDLDAYNTKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDALEMRDAVEKPQEFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVLENVQRNLKHINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYRITENDIQIALDDAKINFNEKLSQLQTYMIQFDQYIKDSYDLHDLKIAIANIIDEIIEKLKSLDEHYHIRVNLVKTIHDLHLFIENIDFNKSGSSTASWIQNVDTKYQIRIQIQEKLQQLKRHIQNIDIQHLAGKLKQHIEAIDVRVLLDQLGTTISFERINDILEHVKHFVINLIGDFEVAEKINAFRAKVHELIERYEVDQQIQVLMDKLVELAHQYKLKETIQKLSNVLQQVKIKDYFEKLVGFIDDAVKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIREVTQRLNGEIQALELPQKAEALKLFLEETKATVAVYLESLQDTKITLIINWLQEALSSASLAHMKAKFRETLEDTRDRMYQMDIQQELQRYLSLVGQVYSTLVTYISDWWTLAAKNLTDFAEQYSIQDWAKRMKALVEQGFTVPEIKTILGTMPAFEVSLQALQKATFQTPDFIVPLTDLRIPSVQINFKDLKNIKIPSRFSTPEFTILNTFHIPSFTIDFVEMKVKIIRTIDQMLNSELQWPVPDIYLRDLKVEDIPLARITLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPEFQLPHISHTIEVPTFGKLYSILKIQSPLFTLDANADIGNGTTSANEAGIAASITAKGESKLEVLNFDFQANAQLSNPKINPLALKESVKFSSKYLRTEHGSEMLFFGNAIEGKSNTVASLHTEKNTLELSNGVIVKINNQLTLDSNTKYFHKLNIPKLDFSSQADLRNEIKTLLKAGHIAWTSSGKGSWKWACPRFSDEGTHESQISFTIEGPLTSFGLSNKINSKHLRVNQNLVYESGSLNFSKLEIQSQVDSQHVGHSVLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVRFPLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQNFSAGNNENIMEAHVGINGEANLDFLNIPLTIPEMRLPYTIITTPPLKDFSLWEKTGLKEFLKTTKQSFDLSVKAQYKKNKHRHSITNPLAVLCEFISQSIKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEKSHDELPRTFQIPGYTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILPSLELPVLHVPRNLKLSLPDFKELCTISHIFIPAMGNITYDFSFKSSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGSHNSTVSLTTKNMEVSVATTTKAQIPILRMNFKQELNGNTKSKPTVSSSMEFKYDFNSSMLYSTAKGAVDHKLSLESLTSYFSIESSTKGDVKGSVLSREYSGTIASEANTYLNSKSTRSSVKLQGTSKIDDIWNLEVKENFAGEATLQRIYSLWEHSTKNHLQLEGLFFTNGEHTSKATLELSPWQMSALVQVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVELSNDQEKAHLDIAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQHLRVSTAFVYTKNPNGYSFSIPVKVLADKFIIPGLKLNDLNSVLVMPTFHVPFTDLQVPSCKLDFREIQIYKKLRTSSFALNLPTLPEVKFPEVDVLTKYSQPEDSLIPFFEITVPESQLTVSQFTLPKSVSDGIAALDLNAVANKIADFELPTIIVPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDSPVYNATWSASLKNKADYVETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGTFAHRDFSAEYEEDGKYEGLQEWEGKAHLNIKSPAFTDLHLRYQKDKKGISTSAASPAVGTVGMDMDEDDDFSKWNFYYSPQSSPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGVLYDYVNKYHWEHTGLTLREVSSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQKAASGTTGTYQEWKDKAQNLYQELLTQEGQASFQGLKDNVFDGLVRVTQEFHMKVKHLIDSLIDFLNFPRFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKVHNGSEILFSYFQDLVITLPFELRKHKLIDVISMYRELLKDLSKEAQEVFKAIQSLKTTEVLRNLQDLLQFIFQLIEDNIKQLKEMKFTYLINYIQDEINTIFSDYIPYVFKLLKENLCLNLHKFNEFIQNELQEASQELQQIHQYIMALREEYFDPSIVGWTVKYYELEEKIVSLIKNLLVALKDFHSEYIVSASNFTSQLSSQVEQFLHRNIQEYLSILTDPDGKGKEKIAELSATAQEIIKSQAIATKKIISDYHQQFRYKLQDFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLIYITELLKKLQSTTVMNPYMKLAPGELTIIL | |||||||
Glycosylation | 34 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Disulfide bond | 39↔88 | UniProt | |||||
Sequence: CPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLC | |||||||
Disulfide bond | 78↔97 | UniProt | |||||
Sequence: CKVELEVPQLCSFILKTSQC | |||||||
Glycosylation | 185 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Disulfide bond | 186↔212 | UniProt | |||||
Sequence: CSTHFTVKTRKGNVATEISTERDLGQC | |||||||
Disulfide bond | 245↔261 | UniProt | |||||
Sequence: CQYTLDAKRKHVAEAIC | |||||||
Disulfide bond | 385↔390 | UniProt | |||||
Sequence: CGQPQC | |||||||
Disulfide bond | 478↔513 | UniProt | |||||
Sequence: CTGDEDYTYLILRVIGNMGQTMEQLTPELKSSILKC | |||||||
Disulfide bond | 966↔976 | UniProt | |||||
Sequence: CKQVFPGLNYC | |||||||
Glycosylation | 983 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Lipidation | 1112 | UniProt | S-palmitoyl cysteine | ||||
Sequence: C | |||||||
Glycosylation | 1368 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 1377 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 1523 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Modified residue (large scale data) | 1775 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2004 | UniProt | N6-acetyllysine | ||||
Sequence: K | |||||||
Glycosylation | 2239 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 2560 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 2779 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 2982 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 3101 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Disulfide bond | 3194↔3324 | UniProt | |||||
Sequence: CEFISQSIKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEKSHDELPRTFQIPGYTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILPSLELPVLHVPRNLKLSLPDFKELC | |||||||
Glycosylation | 3224 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Modified residue | 3279 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Glycosylation | 3336 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 3358 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 3411 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 3465 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 3895 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Modified residue | 4048 | UniProt | Phosphoserine; by FAM20C | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4048 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4052 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 4052 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Glycosylation | 4237 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 4431 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Palmitoylated; structural requirement for proper assembly of the hydrophobic core of the lipoprotein particle.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Induction
Up-regulated in response to enterovirus 71 (EV71) infection (at protein level).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with PCSK9 (PubMed:22580899).
Interacts with MTTP (PubMed:26224785, PubMed:27206948).
Interacts with AUP1 (PubMed:28183703).
Interacts with CIDEB (By similarity).
Interacts with MTTP (PubMed:26224785, PubMed:27206948).
Interacts with AUP1 (PubMed:28183703).
Interacts with CIDEB (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P04114 | LDLR P01130 | 4 | EBI-3926040, EBI-988319 | |
BINARY | P04114 | MTTP P55157 | 4 | EBI-3926040, EBI-11614052 | |
XENO | P04114 | PRO_0000037946 P29991 | 3 | EBI-3926040, EBI-8826488 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 32-126 | Heparin-binding | ||||
Sequence: LENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAM | ||||||
Domain | 46-672 | Vitellogenin | ||||
Sequence: FKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFGEGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTGDEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESM | ||||||
Region | 232-306 | Heparin-binding | ||||
Sequence: TRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFGEGTKKM | ||||||
Region | 902-959 | Heparin-binding | ||||
Sequence: NTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPLIEN | ||||||
Region | 2043-2178 | Heparin-binding | ||||
Sequence: RDAVEKPQEFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVLENVQRNLKHINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYRITENDIQIALDDAKINFNEKLSQLQTYM | ||||||
Region | 3161-3236 | Heparin-binding | ||||
Sequence: FLKTTKQSFDLSVKAQYKKNKHRHSITNPLAVLCEFISQSIKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAE | ||||||
Region | 3174-3184 | Basic (possible receptor binding region) | ||||
Sequence: KAQYKKNKHRH | ||||||
Region | 3373-3393 | LDL receptor binding | ||||
Sequence: VIDALQYKLEGTTRLTRKRGL | ||||||
Region | 3383-3516 | Heparin-binding | ||||
Sequence: GTTRLTRKRGLKLATALSLSNKFVEGSHNSTVSLTTKNMEVSVATTTKAQIPILRMNFKQELNGNTKSKPTVSSSMEFKYDFNSSMLYSTAKGAVDHKLSLESLTSYFSIESSTKGDVKGSVLSREYSGTIASE | ||||||
Region | 3386-3394 | Basic (possible receptor binding region) | ||||
Sequence: RLTRKRGLK |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length4,563
- Mass (Da)515,545
- Last updated2024-01-24 v3
- ChecksumD1073B2D5172A370
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A8MUN2 | A8MUN2_HUMAN | APOB | 828 | ||
A0AAG2UUR8 | A0AAG2UUR8_HUMAN | APOB | 135 | ||
A0AAG2UUW0 | A0AAG2UUW0_HUMAN | APOB | 4563 | ||
A0A669KB70 | A0A669KB70_HUMAN | APOB | 179 |
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 11-13 | in Ref. 5; AAB60718/CAA28420 | ||||
Sequence: Missing | ||||||
Sequence conflict | 329 | in Ref. 3; AAA35549 | ||||
Sequence: L → V | ||||||
Sequence conflict | 645 | in Ref. 3; AAA35549 | ||||
Sequence: L → I | ||||||
Sequence conflict | 704 | in Ref. 4; AAB04636 | ||||
Sequence: L → P | ||||||
Sequence conflict | 792-809 | in Ref. 12; AAA51759 | ||||
Sequence: LQLLGKLLLMGARTLQGI → SSSWKAASHGCPHSAGD | ||||||
Sequence conflict | 793 | in Ref. 4; AAB04636 | ||||
Sequence: Q → R | ||||||
Sequence conflict | 893 | in Ref. 13; AA sequence | ||||
Sequence: D → K | ||||||
Sequence conflict | 919 | in Ref. 3; AAA35549 | ||||
Sequence: A → P | ||||||
Sequence conflict | 1109 | in Ref. 5; CAA28420 | ||||
Sequence: H → D | ||||||
Sequence conflict | 1180 | in Ref. 8; AAA51752 | ||||
Sequence: T → R | ||||||
Sequence conflict | 1271 | in Ref. 4; AAB04636 | ||||
Sequence: F → S | ||||||
Sequence conflict | 1418 | in Ref. 5; CAA28420 | ||||
Sequence: F → S | ||||||
Sequence conflict | 1445 | in Ref. 8; AAA51752 | ||||
Sequence: N → I | ||||||
Sequence conflict | 1535 | in Ref. 8; AAA51752 | ||||
Sequence: G → E | ||||||
Sequence conflict | 1867 | in Ref. 4; AAB04636 | ||||
Sequence: R → G | ||||||
Sequence conflict | 2098 | in Ref. 5; CAA28420 | ||||
Sequence: N → K | ||||||
Sequence conflict | 2218 | in Ref. 4; AAB04636 | ||||
Sequence: I → T | ||||||
Sequence conflict | 2221 | in Ref. 5; CAA28420 | ||||
Sequence: N → I | ||||||
Sequence conflict | 2324-2326 | in Ref. 16; AAA51741 | ||||
Sequence: LIG → PYW | ||||||
Sequence conflict | 2353 | in Ref. 16; AAA51741 | ||||
Sequence: Q → H | ||||||
Sequence conflict | 2540 | in Ref. 5; CAA28420 | ||||
Sequence: G → S | ||||||
Sequence conflict | 2718-2737 | in Ref. 15; AAA51758 | ||||
Sequence: Missing | ||||||
Sequence conflict | 2933 | in Ref. 4; AAB04636 | ||||
Sequence: C → S | ||||||
Sequence conflict | 3114 | in Ref. 13; AA sequence | ||||
Sequence: H → L | ||||||
Sequence conflict | 3131 | in Ref. 13; AA sequence | ||||
Sequence: T → R | ||||||
Sequence conflict | 3134 | in Ref. 13; AA sequence | ||||
Sequence: E → P | ||||||
Sequence conflict | 3137 | in Ref. 13; AA sequence | ||||
Sequence: L → R | ||||||
Sequence conflict | 3239 | in Ref. 5; CAA28420 | ||||
Sequence: H → Q | ||||||
Sequence conflict | 3286 | in Ref. 4; AAB04636 | ||||
Sequence: L → I | ||||||
Sequence conflict | 3291 | in Ref. 15; AAA51758 | ||||
Sequence: R → L | ||||||
Sequence conflict | 3337 | in Ref. 15; AAA51758 | ||||
Sequence: I → N | ||||||
Sequence conflict | 3431 | in Ref. 4; AAB04636 | ||||
Sequence: A → P | ||||||
Sequence conflict | 3728 | in Ref. 24; AAA51742 | ||||
Sequence: D → N | ||||||
Sequence conflict | 3782 | in Ref. 4; AAB04636 | ||||
Sequence: N → T | ||||||
Sequence conflict | 3824 | in Ref. 5; CAA28420 and 23; AAA51750 | ||||
Sequence: Q → R | ||||||
Sequence conflict | 3876 | in Ref. 3; AAA35549 and 24; AAA51742 | ||||
Sequence: V → A | ||||||
Sequence conflict | 3911 | in Ref. 10; AA sequence | ||||
Sequence: T → Y | ||||||
Sequence conflict | 3983 | in Ref. 24; AAA51742 | ||||
Sequence: F → S | ||||||
Sequence conflict | 4002 | in Ref. 24; AAA51742 | ||||
Sequence: A → P | ||||||
Sequence conflict | 4110-4111 | in Ref. 3; AAA35549 and 24; AAA51742 | ||||
Sequence: NN → DH | ||||||
Sequence conflict | 4122 | in Ref. 3; AAA35549 and 24; AAA51742 | ||||
Sequence: Q → E | ||||||
Sequence conflict | 4128 | in Ref. 3; AAA35549 and 24; AAA51742 | ||||
Sequence: V → E | ||||||
Sequence conflict | 4133 | in Ref. 3; AAA35549 and 24; AAA51742 | ||||
Sequence: A → G | ||||||
Sequence conflict | 4188 | in Ref. 4; AAB04636 | ||||
Sequence: H → K | ||||||
Sequence conflict | 4217-4218 | in Ref. 26; AAA35548 | ||||
Sequence: CT → FP | ||||||
Sequence conflict | 4221 | in Ref. 4; AAB04636 | ||||
Sequence: I → M |
Polymorphism
Genetic variations in APOB define the low density lipoprotein cholesterol level quantitative trait locus 4 (LDLCQ4) [MIM:615558].
RNA Editing
Edited at position 2180
The stop codon (UAA) at position 2180 is created by an APOBEC1-containing mRNA editing complex. Apo B-48, derived from the fully edited RNA, is produced only in the intestine and is found in chylomicrons. Apo B-48 is a shortened form of apo B-100 which lacks the LDL-receptor region. The unedited version (apo B-100) is produced by the liver and is found in the VLDL and LDL
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X04506 EMBL· GenBank· DDBJ | CAA28191.1 EMBL· GenBank· DDBJ | mRNA | ||
M19828 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19808 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19809 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19810 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19811 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19812 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19813 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19815 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19816 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19818 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19820 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19821 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19823 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19824 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19825 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M19827 EMBL· GenBank· DDBJ | AAB00481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
J02610 EMBL· GenBank· DDBJ | AAA35549.1 EMBL· GenBank· DDBJ | mRNA | ||
M14162 EMBL· GenBank· DDBJ | AAB04636.1 EMBL· GenBank· DDBJ | mRNA | ||
M15053 EMBL· GenBank· DDBJ | AAB60718.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X04714 EMBL· GenBank· DDBJ | CAA28420.1 EMBL· GenBank· DDBJ | mRNA | ||
AY324608 EMBL· GenBank· DDBJ | AAP72970.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC010872 EMBL· GenBank· DDBJ | AAX88848.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC115619 EMBL· GenBank· DDBJ | AAX93246.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M14081 EMBL· GenBank· DDBJ | AAA51752.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
M12681 EMBL· GenBank· DDBJ | AAA51753.1 EMBL· GenBank· DDBJ | mRNA | ||
M12480 EMBL· GenBank· DDBJ | AAA51751.1 EMBL· GenBank· DDBJ | mRNA | ||
K03175 EMBL· GenBank· DDBJ | AAA51759.1 EMBL· GenBank· DDBJ | mRNA | ||
M15421 EMBL· GenBank· DDBJ | AAA51758.1 EMBL· GenBank· DDBJ | mRNA | ||
M17367 EMBL· GenBank· DDBJ | AAA51741.1 EMBL· GenBank· DDBJ | mRNA | ||
M31030 EMBL· GenBank· DDBJ | AAA51756.1 EMBL· GenBank· DDBJ | mRNA | ||
X03325 EMBL· GenBank· DDBJ | CAA27044.1 EMBL· GenBank· DDBJ | mRNA | ||
X03326 EMBL· GenBank· DDBJ | CAA27045.1 EMBL· GenBank· DDBJ | mRNA | ||
M17779 EMBL· GenBank· DDBJ | AAA51755.1 EMBL· GenBank· DDBJ | mRNA | ||
M19734 EMBL· GenBank· DDBJ | AAA35544.1 EMBL· GenBank· DDBJ | mRNA | ||
M18471 EMBL· GenBank· DDBJ | AAA35541.1 EMBL· GenBank· DDBJ | mRNA | ||
X03045 EMBL· GenBank· DDBJ | CAA26850.1 EMBL· GenBank· DDBJ | mRNA | ||
M10374 EMBL· GenBank· DDBJ | AAA51750.1 EMBL· GenBank· DDBJ | mRNA | ||
M12413 EMBL· GenBank· DDBJ | AAA51742.1 EMBL· GenBank· DDBJ | mRNA | ||
M36676 EMBL· GenBank· DDBJ | AAA35548.1 EMBL· GenBank· DDBJ | mRNA |