P04073 · PEPC_RAT
- ProteinGastricsin
- GenePgc
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids392 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Hydrolyzes a variety of proteins.
Catalytic activity
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 94 | |||||
Sequence: D | ||||||
Active site | 280 | |||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Molecular Function | aspartic-type endopeptidase activity | |
Biological Process | digestion | |
Biological Process | positive regulation of antibacterial peptide production | |
Biological Process | proteolysis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameGastricsin
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionP04073
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
Chemistry
PTM/Processing
Features
Showing features for signal, propeptide, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MKWMVVALLCLPLLEA | ||||||
Propeptide | PRO_0000026069 | 17-62 | Activation peptide | |||
Sequence: SLLRVPLRKMKSIRETMKEQGVLKDFLKTHKYDPGQKYHFGNFGDY | ||||||
Chain | PRO_0000026070 | 63-392 | Gastricsin | |||
Sequence: SVLYEPMAYMDASYFGEISIGTPPQNFLVLFDTGSSNLWVSSVYCQSEACTTHARFNPSKSSTYYTEGQTFSLQYGTGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPGLSSGGATTALQGMLGEGALSQPLFGVYLGSQQGSNGGQIVFGGVDKNLYTGEITWVPVTQELYWQITIDDFLIGDQASGWCSSQGCQGIVDTGTSLLVMPAQYLSELLQTIGAQEGEYGEYFVSCDSVSSLPTLSFVLNGVQFPLSPSSYIIQEDNFCMVGLESISLTSESGQPLWILGDVFLRSYYAIFDMGNNKVGLATSV | ||||||
Disulfide bond | 107↔112 | |||||
Sequence: CQSEAC | ||||||
Disulfide bond | 270↔275 | |||||
Sequence: CSSQGC | ||||||
Disulfide bond | 314↔347 | |||||
Sequence: CDSVSSLPTLSFVLNGVQFPLSPSSYIIQEDNFC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 76-389 | Peptidase A1 | ||||
Sequence: YFGEISIGTPPQNFLVLFDTGSSNLWVSSVYCQSEACTTHARFNPSKSSTYYTEGQTFSLQYGTGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPGLSSGGATTALQGMLGEGALSQPLFGVYLGSQQGSNGGQIVFGGVDKNLYTGEITWVPVTQELYWQITIDDFLIGDQASGWCSSQGCQGIVDTGTSLLVMPAQYLSELLQTIGAQEGEYGEYFVSCDSVSSLPTLSFVLNGVQFPLSPSSYIIQEDNFCMVGLESISLTSESGQPLWILGDVFLRSYYAIFDMGNNKVGLA |
Sequence similarities
Belongs to the peptidase A1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length392
- Mass (Da)42,833
- Last updated1986-11-01 v1
- Checksum092A5EAF2783EDD1
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 31 | in Ref. 3; AA sequence | ||||
Sequence: E → Q | ||||||
Sequence conflict | 103 | in Ref. 3; AA sequence | ||||
Sequence: S → A | ||||||
Sequence conflict | 109 | in Ref. 3; AA sequence | ||||
Sequence: S → L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X04644 EMBL· GenBank· DDBJ | CAA28305.1 EMBL· GenBank· DDBJ | mRNA | ||
M25993 EMBL· GenBank· DDBJ | AAA41827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M25985 EMBL· GenBank· DDBJ | AAA41827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M25986 EMBL· GenBank· DDBJ | AAA41827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M25987 EMBL· GenBank· DDBJ | AAA41827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M25988 EMBL· GenBank· DDBJ | AAA41827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M25989 EMBL· GenBank· DDBJ | AAA41827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M25990 EMBL· GenBank· DDBJ | AAA41827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M25991 EMBL· GenBank· DDBJ | AAA41827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M25992 EMBL· GenBank· DDBJ | AAA41827.1 EMBL· GenBank· DDBJ | Genomic DNA |