P03847 · COPB2_ECOLX
- ProteinReplication regulatory protein repA2
- GenerepA2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existencePredicted
- Annotation score2/5
Function
function
This protein is involved in the determination of copy number in gene replication. It binds to the repA promoter thus inhibiting the synthesis of the mRNA for the initiator protein RepA.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | DNA binding | |
Biological Process | plasmid maintenance |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameReplication regulatory protein repA2
- Alternative names
Gene names
Encoded on
- Plasmid IncFII R100 (NR1)
- Plasmid R6-5
- Plasmid IncFVI pSU212
Organism names
- Organism
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Escherichia
Accessions
- Primary accessionP03847
- Secondary accessions
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000068291 | 1-84 | Replication regulatory protein repA2 | |||
Sequence: MSQTENAVTSSSGAKRAYRKGNPLSDAEKQRLSVARKRASFKEVKVFLEPKYKAMLMQMCHEDGLTQAEVLTALIKSEAQKRCM |
Structure
Sequence
- Sequence statusComplete
- Length84
- Mass (Da)9,438
- Last updated1994-02-01 v2
- ChecksumADC3442D128E2C81
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MSQTENAVTSSSGAKR | ||||||
Sequence conflict | 3 | in Ref. 2; AAA26065 | ||||
Sequence: Q → H | ||||||
Sequence conflict | 77-84 | in Ref. 2; AAA26065 | ||||
Sequence: SEAQKRCM → K | ||||||
Sequence conflict | 81-84 | in Ref. 1 | ||||
Sequence: KRCM → NDACDDGLTFLSVQKISARLLIV |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
J01762 EMBL· GenBank· DDBJ | AAA92255.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M26840 EMBL· GenBank· DDBJ | AAA26065.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
V00318 EMBL· GenBank· DDBJ | CAA23608.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M18273 EMBL· GenBank· DDBJ | AAA88332.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X02302 EMBL· GenBank· DDBJ | CAA26165.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X55895 EMBL· GenBank· DDBJ | CAA39380.1 EMBL· GenBank· DDBJ | Genomic DNA |