P03775 · OCR_BPT7
- ProteinProtein Ocr
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids117 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Prevents both degradation and modification of T7 DNA by the host restriction-modification complex (PubMed:1095770, PubMed:32039758).
Structural mimic of the phosphate backbone of B-form DNA that binds to and completely occupies the DNA-binding sites of all known families of the complex type I DNA restriction enzymes (PubMed:12235377, PubMed:32483229).
Thereby, inhibits the restriction endonuclease activity and protects the phage genome as it penetrates into host cytoplasm (PubMed:12235377, PubMed:32483229).
Inhibits host transcription by binding to the bacterial RNAP and competing with sigma factors (PubMed:32039758).
Inhibits the host exclusion defense system BREX (PubMed:32338761).
Structural mimic of the phosphate backbone of B-form DNA that binds to and completely occupies the DNA-binding sites of all known families of the complex type I DNA restriction enzymes (PubMed:12235377, PubMed:32483229).
Thereby, inhibits the restriction endonuclease activity and protects the phage genome as it penetrates into host cytoplasm (PubMed:12235377, PubMed:32483229).
Inhibits host transcription by binding to the bacterial RNAP and competing with sigma factors (PubMed:32039758).
Inhibits the host exclusion defense system BREX (PubMed:32338761).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Biological Process | symbiont-mediated evasion of host restriction-modification system | |
Biological Process | symbiont-mediated suppression of host innate immune response | |
Biological Process | virus-mediated perturbation of host defense response |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein Ocr
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes > Autographiviridae > Studiervirinae > Teseptimavirus > Teseptimavirus T7
- Virus hosts
Accessions
- Primary accessionP03775
Proteomes
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 54 | Partial loss of inhibition of the host exclusion defense system BREX; when associated with E-58. | ||||
Sequence: F → D | ||||||
Mutagenesis | 58 | Partial loss of inhibition of the host exclusion defense system BREX; when associated with D-54. | ||||
Sequence: A → E |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000106462 | 1-117 | Protein Ocr | |||
Sequence: MAMSNMTYNNVFDHAYEMLKENIRYDDIRDTDDLHDAIHMAADNAVPHYYADIFSVMASEGIDLEFEDSGLMPDTKDVIRILQARIYEQLTIDLWEDAEDLLNEYLEEVEEYEEDEE |
Expression
Keywords
- Developmental stage
Interaction
Subunit
Homodimer (PubMed:32039758, PubMed:6257722).
Interacts with HsdM (AC P08957), the M subunit of host type I methyltransferase restriction enzyme M.EcoKI; 1 Ocr dimer binds to M.EcoKI (PubMed:12235377, PubMed:19074193).
Interacts with HsdR (AC P08956), the R subunit of host type I bifunctional endonuclease and methyltransferase restriction enzyme R.EcoKI; 2 Ocr dimers binds to R.EcoKI (PubMed:12235377, PubMed:32483229).
Interacts with host PglX/BrxX (AC P0DUF9); this interaction decreases by 20% the pglX-mediated methylated sites required for self versus non-self differentiation by the host (PubMed:32338761).
Interacts with HsdM (AC P08957), the M subunit of host type I methyltransferase restriction enzyme M.EcoKI; 1 Ocr dimer binds to M.EcoKI (PubMed:12235377, PubMed:19074193).
Interacts with HsdR (AC P08956), the R subunit of host type I bifunctional endonuclease and methyltransferase restriction enzyme R.EcoKI; 2 Ocr dimers binds to R.EcoKI (PubMed:12235377, PubMed:32483229).
Interacts with host PglX/BrxX (AC P0DUF9); this interaction decreases by 20% the pglX-mediated methylated sites required for self versus non-self differentiation by the host (PubMed:32338761).
Protein-protein interaction databases
Sequence
- Sequence statusComplete
- Length117
- Mass (Da)13,809
- Last updated1986-07-21 v1
- ChecksumBB7D3D45068EB17D
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 43 | in Ref. 3; AAA32564 | ||||
Sequence: D → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M38334 EMBL· GenBank· DDBJ | AAA32564.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
V01146 EMBL· GenBank· DDBJ | CAA24384.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
V01127 EMBL· GenBank· DDBJ | CAA24327.1 EMBL· GenBank· DDBJ | Genomic DNA |