P03674 · G6P_BPIKE
- ProteinHead virion protein G6P
- GeneVI
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids116 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Plays essential roles both in the entry of the viral genome into the bacterial host and in budding process. The formation of the G3P-G6P complex termed adsorption complex is essential for correct termination of filamentous phage assembly (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell membrane | |
Cellular Component | membrane | |
Cellular Component | virion component | |
Biological Process | symbiont entry into host cell |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameHead virion protein G6P
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Monodnaviria > Loebvirae > Hofneiviricota > Faserviricetes > Tubulavirales > Inoviridae > Lineavirus > Lineavirus IKe
- Virus hosts
Accessions
- Primary accessionP03674
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Host membrane ; Multi-pass membrane protein
Note: Prior to assembly, G6P is found associated with the bacterial host inner membrane. There are about five copies of G6P in the mature virion. They are located together with G3P at the head side of the filamentous virion (By similarity).
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 13-33 | Helical | ||||
Sequence: FIMGLVPIAIGYFAKFLGMII | ||||||
Transmembrane | 38-58 | Helical | ||||
Sequence: LMASALIGAILSVVSFSIQLL | ||||||
Transmembrane | 84-104 | Helical | ||||
Sequence: GTTTCITVIITTRIAVFVFDI |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000098193 | 1-116 | Head virion protein G6P | |||
Sequence: MPALLGIPALIRFIMGLVPIAIGYFAKFLGMIITRNGLMASALIGAILSVVSFSIQLLGDALSSSMGGISADFGNLMSSVLPDGTTTCITVIITTRIAVFVFDIKDRLLGIANKVI |
Interaction
Subunit
Interacts with G3P; this interaction is required for proper integration of G3P and G6P into the virion.
Structure
Family & Domains
Sequence similarities
Belongs to the inovirus G6P protein family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length116
- Mass (Da)12,118
- Last updated1986-07-21 v1
- ChecksumE32685717F13994C
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X02139 EMBL· GenBank· DDBJ | CAA26074.1 EMBL· GenBank· DDBJ | Genomic DNA |