P03515 · NCAP_PTPV
- ProteinNucleoprotein
- GeneN
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids243 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Encapsidates the genomic RNA, protecting it from nucleases. Displays high affinity for single-stranded nucleic acid. The encapsidated genomic RNA is termed the nucleocapsid (NC) or ribonucleoprotein. The ribonucleoprotein has a non-helical structure (By similarity).
Serves as template for viral transcription and replication. After replication, the nucleocapsid is recruited to the host Golgi apparatus by glycoprotein Gn for packaging into virus particles (By similarity).
Serves as template for viral transcription and replication. After replication, the nucleocapsid is recruited to the host Golgi apparatus by glycoprotein Gn for packaging into virus particles (By similarity).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 29 | RNA-binding | ||||
Sequence: Y | ||||||
Site | 32 | RNA-binding | ||||
Sequence: F | ||||||
Site | 65 | RNA-binding | ||||
Sequence: N | ||||||
Site | 66 | RNA-binding | ||||
Sequence: K | ||||||
Site | 98 | RNA-binding | ||||
Sequence: R | ||||||
Site | 105 | RNA-binding | ||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | helical viral capsid | |
Cellular Component | host cell endoplasmic reticulum-Golgi intermediate compartment | |
Cellular Component | host cell Golgi apparatus | |
Cellular Component | host cell nucleus | |
Cellular Component | ribonucleoprotein complex | |
Cellular Component | viral nucleocapsid | |
Molecular Function | RNA binding |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameNucleoprotein
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Negarnaviricota > Polyploviricotina > Ellioviricetes > Bunyavirales > Phenuiviridae > Phlebovirus > Phlebovirus toroense
- Virus hosts
Accessions
- Primary accessionP03515
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000221994 | 1-243 | Nucleoprotein | |||
Sequence: MSYEEIAVQFASESIDEQTVAGWVTDFAYQGFDAKRVIALVKDRGGEDWKQDVKKMIVLSLTRGNKPNKMILKMSDKGKAMVNELVLKYKLKSGNPSRDDLTLSRITAAFAGWTCQAADYVQEYLPVTGRAMDAISSSYPRAMMHPSFAGLIDQELPADVFSEITQAHCLFMIQFSKTINPSLRGLSKDEIVSSFERPMQAAISSTFLTSANRRAMLKTLGIINDNLKPSSSTVSAAKVFRSL |
Interaction
Subunit
Homodimer. Homohexamer; ring-shaped, necessary to form the nucleocapsid (By similarity).
Homopentamers; opened pentamers in solution (By similarity).
Binds to viral genomic RNA (By similarity).
Interacts with glycoprotein Gn; this interaction allows packaging of nucleocapsids into virions (By similarity).
Homopentamers; opened pentamers in solution (By similarity).
Binds to viral genomic RNA (By similarity).
Interacts with glycoprotein Gn; this interaction allows packaging of nucleocapsids into virions (By similarity).
Family & Domains
Sequence similarities
Belongs to the phlebovirus nucleocapsid protein family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length243
- Mass (Da)26,911
- Last updated1986-07-21 v1
- Checksum0CE34C9E1DBA0589