P03077 · MT_POVMA
- ProteinMiddle T antigen
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids421 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell membrane | |
Cellular Component | membrane |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMiddle T antigen
- Short namesMT; MT-AG
Organism names
- Taxonomic lineageViruses > Monodnaviria > Shotokuvirae > Cossaviricota > Papovaviricetes > Sepolyvirales > Polyomaviridae > Alphapolyomavirus > Mus musculus polyomavirus 1
- Virus hosts
Accessions
- Primary accessionP03077
Proteomes
Subcellular Location
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-394 | Cytoplasmic | ||||
Sequence: MDRVLSRADKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNLRMNLGGTGFQVRRLHADGWNLSTKDTFGDRYYQRFCRMPLTCLVNVKYSSCSCILCLLRKQHRELKDKCDARCLVLGECFCLECYMQWFGTPTRDVLNLYADFIASMPIDWLDLDVHSVYNPKRRSEELRRAATVHYTMTTGHSAMEASTSQGNGMISSESGTPATSRRLRLPSLLSNPTYSVMRSHSYPPTRVLQQIHPHILLEEDEILVLLSPMTAYPRTPPELLYPESDQDQLEPLEEEEEEYMPMEDLYLDILPGEQVPQLIPPPIIPRAGLSPWEGLILRDLQRAHFDPILDASQRMRATHRAALRAHSMQRHLRRLGRT | ||||||
Transmembrane | 395-415 | Helical | ||||
Sequence: LLLVTFLAALLGICLMLFILI | ||||||
Topological domain | 416-421 | Extracellular | ||||
Sequence: KRSRHF |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 160 | Complete loss of transformation ability. | ||||
Sequence: T → A | ||||||
Mutagenesis | 248 | Complete loss of association with host Shc1. | ||||
Sequence: P → H | ||||||
Mutagenesis | 250 | Complete loss of association with host Shc1. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 257 | Complete loss of interaction with host Ywhaz. | ||||
Sequence: S → A | ||||||
Mutagenesis | 315 | 90% loss of association with host p85. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 322 | Complete loss of association with host Plcg1. | ||||
Sequence: Y → F |
Keywords
- Disease
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000115049 | 1-421 | Middle T antigen | |||
Sequence: MDRVLSRADKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNLRMNLGGTGFQVRRLHADGWNLSTKDTFGDRYYQRFCRMPLTCLVNVKYSSCSCILCLLRKQHRELKDKCDARCLVLGECFCLECYMQWFGTPTRDVLNLYADFIASMPIDWLDLDVHSVYNPKRRSEELRRAATVHYTMTTGHSAMEASTSQGNGMISSESGTPATSRRLRLPSLLSNPTYSVMRSHSYPPTRVLQQIHPHILLEEDEILVLLSPMTAYPRTPPELLYPESDQDQLEPLEEEEEEYMPMEDLYLDILPGEQVPQLIPPPIIPRAGLSPWEGLILRDLQRAHFDPILDASQRMRATHRAALRAHSMQRHLRRLGRTLLLVTFLAALLGICLMLFILIKRSRHF | ||||||
Modified residue | 250 | Phosphotyrosine; by host | ||||
Sequence: Y | ||||||
Modified residue | 257 | Phosphoserine; by host | ||||
Sequence: S | ||||||
Modified residue | 315 | Phosphotyrosine; by host | ||||
Sequence: Y | ||||||
Modified residue | 322 | Phosphotyrosine; by host | ||||
Sequence: Y |
Post-translational modification
Keywords
- PTM
PTM databases
Expression
Keywords
- Developmental stage
Interaction
Subunit
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 12-75 | J | ||||
Sequence: RLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNLRMNLGG | ||||||
Region | 215-237 | Disordered | ||||
Sequence: MEASTSQGNGMISSESGTPATSR |
Domain
Keywords
- Domain
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P03077-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameMiddle T antigen
- Length421
- Mass (Da)48,622
- Last updated1986-07-21 v1
- ChecksumCA0C25C4984CACB7
P68835-1
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- NameSmall t antigen
P03073-1
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- NameLarge T antigen
Keywords
- Coding sequence diversity
- Technical term