P02833 · ANTP_DROME
- ProteinHomeotic protein antennapedia
- GeneAntp
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids378 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. Provides cells with specific positional identities on the anterior-posterior axis.
Miscellaneous
Loss of Antp results in altered development of the embryonic thoracic segments. Overexpression can cause antennae to be transformed into legs.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 297-356 | Homeobox | ||||
Sequence: RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | anterior/posterior axis specification | |
Biological Process | anterior/posterior pattern specification | |
Biological Process | heart development | |
Biological Process | lymph gland development | |
Biological Process | midgut development | |
Biological Process | muscle cell fate specification | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | neuroblast development | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of neurogenesis | |
Biological Process | specification of segmental identity, antennal segment | |
Biological Process | specification of segmental identity, thorax | |
Biological Process | ventral cord development |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHomeotic protein antennapedia
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP02833
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000200259 | 1-378 | Homeotic protein antennapedia | |||
Sequence: MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSPQ |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 48-132 | Disordered | ||||
Sequence: NANHQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAP | ||||||
Compositional bias | 71-132 | Polar residues | ||||
Sequence: GQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAP | ||||||
Region | 230-287 | Disordered | ||||
Sequence: MYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWM | ||||||
Compositional bias | 257-283 | Polar residues | ||||
Sequence: MHQGHPGQHTPPSQNPNSQSSGMPSPL | ||||||
Motif | 283-288 | Antp-type hexapeptide | ||||
Sequence: LYPWMR | ||||||
Region | 352-378 | Disordered | ||||
Sequence: WKKENKTKGEPGSGGEGDEITPPNSPQ |
Sequence similarities
Belongs to the Antp homeobox family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P02833-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsA, B, I, J
- Length378
- Mass (Da)42,760
- Last updated1988-11-01 v1
- ChecksumD653232A8622D055
P02833-2
- Name2
- SynonymsH
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 71-132 | Polar residues | ||||
Sequence: GQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAP | ||||||
Compositional bias | 257-283 | Polar residues | ||||
Sequence: MHQGHPGQHTPPSQNPNSQSSGMPSPL | ||||||
Alternative sequence | VSP_008097 | 296-297 | in isoform 2 | |||
Sequence: ER → GK | ||||||
Alternative sequence | VSP_008098 | 298-378 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 300 | in Ref. 10; AAA79241 | ||||
Sequence: G → E |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X03790 EMBL· GenBank· DDBJ | CAA27417.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X03791 EMBL· GenBank· DDBJ | CAA27417.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M20704 EMBL· GenBank· DDBJ | AAA70214.1 EMBL· GenBank· DDBJ | mRNA | ||
M20705 EMBL· GenBank· DDBJ | AAA70216.1 EMBL· GenBank· DDBJ | mRNA | ||
AE001572 EMBL· GenBank· DDBJ | AAD19793.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAG22205.3 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAS65111.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY060407 EMBL· GenBank· DDBJ | AAL25446.1 EMBL· GenBank· DDBJ | mRNA | ||
M14496 EMBL· GenBank· DDBJ | AAA28376.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
K01948 EMBL· GenBank· DDBJ | AAA28373.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
M12009 EMBL· GenBank· DDBJ | AAA79241.1 EMBL· GenBank· DDBJ | mRNA |