P02774 · VTDB_HUMAN
- ProteinVitamin D-binding protein
- GeneGC
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids474 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | blood microparticle | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | extracellular exosome | |
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Cellular Component | lysosomal lumen | |
Molecular Function | actin binding | |
Molecular Function | calcidiol binding | |
Molecular Function | vitamin D binding | |
Molecular Function | vitamin transmembrane transporter activity | |
Biological Process | vitamin D metabolic process | |
Biological Process | vitamin transport |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameVitamin D-binding protein
- Short namesDBP; VDB
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP02774
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_000548 | 432 | in allele GC*1S; dbSNP:rs7041 | |||
Sequence: D → E | ||||||
Natural variant | VAR_000549 | 436 | in allele GC*2, allele GC*2A9; dbSNP:rs4588 | |||
Sequence: T → K | ||||||
Natural variant | VAR_014120 | 445 | in allele GC*2A9; requires 2 nucleotide substitutions | |||
Sequence: H → C | ||||||
Natural variant | VAR_014121 | 445 | in allele GC*1F, allele GC*2 and allele GC*1S; dbSNP:rs9016 | |||
Sequence: H → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 669 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MKRVLVLLLAVAFGHA | ||||||
Chain | PRO_0000001102 | 17-474 | Vitamin D-binding protein | |||
Sequence: LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL | ||||||
Disulfide bond | 29↔75 | |||||
Sequence: CKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACC | ||||||
Disulfide bond | 74↔83 | |||||
Sequence: CCAEGADPDC | ||||||
Disulfide bond | 96↔112 | |||||
Sequence: CESNSPFPVHPGTAECC | ||||||
Disulfide bond | 111↔122 | |||||
Sequence: CCTKEGLERKLC | ||||||
Disulfide bond | 145↔190 | |||||
Sequence: CEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCC | ||||||
Disulfide bond | 189↔198 | |||||
Sequence: CCTSASPTVC | ||||||
Disulfide bond | 220↔266 | |||||
Sequence: CSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCC | ||||||
Disulfide bond | 265↔273 | |||||
Sequence: CCESASEDC | ||||||
Disulfide bond | 286↔300 | |||||
Sequence: CDNLSTKNSKFEDCC | ||||||
Disulfide bond | 299↔311 | |||||
Sequence: CCQEKTAMDVFVC | ||||||
Disulfide bond | 335↔376 | |||||
Sequence: CDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECC | ||||||
Disulfide bond | 375↔384 | |||||
Sequence: CCDVEDSTTC | ||||||
Disulfide bond | 407↔453 | |||||
Sequence: CADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCC | ||||||
Disulfide bond | 452↔462 | |||||
Sequence: CCSINSPPLYC |
Post-translational modification
Allele GC*1S is O-glycosylated at Thr-436 (PubMed:20079467).
The trisaccharide sugar moiety can be modified by the successive removal of neuraminic acid and galactose leaving an O-mceeN-acetyl-galactosamine. This conversion is thought to produce a macrophage-activating factor (Gc-MAF). Only a minor proportion of plasma GC is O-glycosylated (PubMed:17360250).
The potential N-glycosylation site predicted at Asn-288 is thought to be nonglycosylated
The trisaccharide sugar moiety can be modified by the successive removal of neuraminic acid and galactose leaving an O-mceeN-acetyl-galactosamine. This conversion is thought to produce a macrophage-activating factor (Gc-MAF). Only a minor proportion of plasma GC is O-glycosylated (PubMed:17360250).
The potential N-glycosylation site predicted at Asn-288 is thought to be nonglycosylated
Keywords
- PTM
Proteomic databases
2D gel databases
PTM databases
Expression
Tissue specificity
Expressed in the liver. Found in plasma, ascites, cerebrospinal fluid and urine.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Associates with membrane-bound immunoglobulin on the surface of B-lymphocytes and with IgG Fc receptor on the membranes of T-lymphocytes. Interacts with LRP2; the interaction is required for renal uptake of GC in complex with 25-hydroxyvitamin D3 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 17-208 | Albumin 1 | ||||
Sequence: LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKH | ||||||
Domain | 209-394 | Albumin 2 | ||||
Sequence: LSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKK | ||||||
Domain | 395-474 | Albumin 3 | ||||
Sequence: ELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL |
Sequence similarities
Belongs to the ALB/AFP/VDB family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 3 isoforms produced by Alternative splicing.
P02774-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length474
- Mass (Da)52,918
- Last updated2018-09-12 v2
- Checksum484BF163B54A43E6
P02774-2
- Name2
- NoteMay be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
- Differences from canonical
- 1-122: Missing
P02774-3
- Name3
- Differences from canonical
- 1-1: M → MLWSWSEERGGAARLSGRKM
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_044523 | 1 | in isoform 3 | |||
Sequence: M → MLWSWSEERGGAARLSGRKM | ||||||
Alternative sequence | VSP_038427 | 1-122 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 168 | in Ref. 1; AAA52173 | ||||
Sequence: G → E | ||||||
Sequence conflict | 183 | in Ref. 5; AK309595 | ||||
Sequence: L → P | ||||||
Sequence conflict | 327 | in Ref. 1; AAA52173 | ||||
Sequence: E → R |
Polymorphism
Over 80 variants of human DBP have been identified. The three most common alleles are called GC*1F, GC*1S, and GC*2. The sequence shown is that of the GC*1A1 allele.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M12654 EMBL· GenBank· DDBJ | AAA52173.1 EMBL· GenBank· DDBJ | mRNA | ||
X03178 EMBL· GenBank· DDBJ | CAA26938.1 EMBL· GenBank· DDBJ | mRNA | ||
S67480 EMBL· GenBank· DDBJ | AAB29423.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S67474 EMBL· GenBank· DDBJ | AAB29423.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S67476 EMBL· GenBank· DDBJ | AAB29423.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S67478 EMBL· GenBank· DDBJ | AAB29423.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S67479 EMBL· GenBank· DDBJ | AAB29423.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S67526 EMBL· GenBank· DDBJ | AAB29423.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L10641 EMBL· GenBank· DDBJ | AAA61704.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK290827 EMBL· GenBank· DDBJ | BAF83516.1 EMBL· GenBank· DDBJ | mRNA | ||
AK298433 EMBL· GenBank· DDBJ | BAG60654.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AK309595 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AK315853 EMBL· GenBank· DDBJ | BAF98744.1 EMBL· GenBank· DDBJ | mRNA | ||
AK223458 EMBL· GenBank· DDBJ | BAD97178.1 EMBL· GenBank· DDBJ | mRNA | ||
AC024722 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471057 EMBL· GenBank· DDBJ | EAX05645.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC057228 EMBL· GenBank· DDBJ | AAH57228.1 EMBL· GenBank· DDBJ | mRNA | ||
M17156 EMBL· GenBank· DDBJ | AAA19662.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
S77129 EMBL· GenBank· DDBJ | AAD14249.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
S77130 EMBL· GenBank· DDBJ | AAD14250.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. |