P02655 · APOC2_HUMAN
- ProteinApolipoprotein C-II
- GeneAPOC2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids101 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameApolipoprotein C-II
- Short namesApo-CII; ApoC-II
- Alternative names
- Cleaved into 1 chains
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP02655
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Hyperlipoproteinemia 1B (HLPP1B)
- Note
- DescriptionAutosomal recessive trait characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis.
- See alsoMIM:207750
Natural variants in HLPP1B
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_000640 | 48 | W>R | in HLPP1B; variant Wakayama; dbSNP:rs120074115 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_000639 | 41 | in dbSNP:rs120074114 | |||
Sequence: K → T | ||||||
Natural variant | VAR_000640 | 48 | in HLPP1B; variant Wakayama; dbSNP:rs120074115 | |||
Sequence: W → R | ||||||
Natural variant | VAR_000641 | 60 | in San Francisco; found in hyperlipidemic patients; dbSNP:rs5122 | |||
Sequence: E → K | ||||||
Natural variant | VAR_000642 | 77 | in Africa; dbSNP:rs5126 | |||
Sequence: K → Q |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 127 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MGTRLLPALFLVLLVLGFEVQG | ||||||
Chain | PRO_0000002024 | 23-101 | Proapolipoprotein C-II | |||
Sequence: TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE | ||||||
Chain | PRO_0000430839 | 29-101 | Apolipoprotein C-II | |||
Sequence: DEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE |
Post-translational modification
Proapolipoprotein C-II is synthesized as a sialic acid containing glycoprotein which is subsequently desialylated prior to its proteolytic processing.
Proapolipoprotein C-II, the major form found in plasma undergoes proteolytic cleavage of its N-terminal hexapeptide to generate apolipoprotein C-II, which occurs as the minor form in plasma.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Liver and intestine.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P02655 | TTPA P49638 | 3 | EBI-1223594, EBI-10210710 | |
BINARY | PRO_0000002024 | APOC2 PRO_0000002024 P02655 | 16 | EBI-25338752, EBI-25338752 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 23-38 | O-glycosylated at one site | ||||
Sequence: TQQPQQDEMPSPTFLT | ||||||
Region | 66-74 | Lipid binding | ||||
Sequence: AVDEKLRDL | ||||||
Region | 78-101 | Lipoprotein lipase cofactor | ||||
Sequence: STAAMSTYTGIFTDQVLSVLKGEE |
Sequence similarities
Belongs to the apolipoprotein C2 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length101
- Mass (Da)11,284
- Last updated1986-07-21 v1
- Checksum51CB86FEDB174D84
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 36 | in Ref. 7; AAP35354 and 8; ACN81313 | ||||
Sequence: F → L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X05151 EMBL· GenBank· DDBJ | CAA28798.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X00568 EMBL· GenBank· DDBJ | CAA25234.1 EMBL· GenBank· DDBJ | mRNA | ||
J02698 EMBL· GenBank· DDBJ | AAA98743.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY422955 EMBL· GenBank· DDBJ | AAQ91814.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT006708 EMBL· GenBank· DDBJ | AAP35354.1 EMBL· GenBank· DDBJ | mRNA | ||
FJ525875 EMBL· GenBank· DDBJ | ACN81313.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471126 EMBL· GenBank· DDBJ | EAW57311.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC005348 EMBL· GenBank· DDBJ | AAH05348.3 EMBL· GenBank· DDBJ | mRNA | ||
M29844 EMBL· GenBank· DDBJ | AAA51743.1 EMBL· GenBank· DDBJ | mRNA | ||
M10612 EMBL· GenBank· DDBJ | AAB59380.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF113884 EMBL· GenBank· DDBJ | AAD28193.1 EMBL· GenBank· DDBJ | mRNA |