P02515 · HSP22_DROME
- ProteinHeat shock protein 22
- GeneHsp22
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids174 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | mitochondrial matrix | |
Cellular Component | nucleus | |
Molecular Function | identical protein binding | |
Molecular Function | unfolded protein binding | |
Biological Process | chaperone-mediated protein folding | |
Biological Process | determination of adult lifespan | |
Biological Process | protein refolding | |
Biological Process | response to heat | |
Biological Process | response to oxidative stress |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHeat shock protein 22
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP02515
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000125963 | 1-174 | Heat shock protein 22 | |||
Sequence: MRSLPMFWRMAEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGEPAKKSAEEPNDKAASQ | ||||||
Modified residue | 152 | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 44-154 | sHSP | ||||
Sequence: QIARWQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIE | ||||||
Compositional bias | 152-168 | Basic and acidic residues | ||||
Sequence: TIEQTGEPAKKSAEEPN | ||||||
Region | 152-174 | Disordered | ||||
Sequence: TIEQTGEPAKKSAEEPNDKAASQ |
Sequence similarities
Belongs to the small heat shock protein (HSP20) family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length174
- Mass (Da)19,763
- Last updated2007-07-10 v4
- Checksum57DE84D754516B7E
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 44 | in Ref. 1; AAA28635 and 2; no nucleotide entry | ||||
Sequence: Q → H | ||||||
Sequence conflict | 53 | in Ref. 1; AAA28635 and 2; no nucleotide entry | ||||
Sequence: F → L | ||||||
Sequence conflict | 54 | in Ref. 2; no nucleotide entry | ||||
Sequence: A → P | ||||||
Sequence conflict | 90 | in Ref. 1; AAA28635 and 2; no nucleotide entry | ||||
Sequence: G → A | ||||||
Sequence conflict | 109-111 | in Ref. 1; AAA28635 | ||||
Sequence: RRF → GRY | ||||||
Sequence conflict | 115 | in Ref. 1; AAA28635 | ||||
Sequence: E → D | ||||||
Sequence conflict | 123-128 | in Ref. 1; AAA28635 | ||||
Sequence: TSTLSS → SSSLSD | ||||||
Compositional bias | 152-168 | Basic and acidic residues | ||||
Sequence: TIEQTGEPAKKSAEEPN | ||||||
Sequence conflict | 168 | in Ref. 1; AAA28635 and 2; no nucleotide entry | ||||
Sequence: N → K | ||||||
Sequence conflict | 171 | in Ref. 1; AAA28635 and 2; no nucleotide entry | ||||
Sequence: A → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
J01098 EMBL· GenBank· DDBJ | AAA28635.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014296 EMBL· GenBank· DDBJ | AAF50290.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014296 EMBL· GenBank· DDBJ | AAN11962.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY060412 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AY119034 EMBL· GenBank· DDBJ | AAM50894.1 EMBL· GenBank· DDBJ | mRNA |