P02309 · H4_YEAST
- ProteinHistone H4
- GeneHHF1; HHF2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids103 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Component of the UAF (upstream activation factor) complex which interacts with the upstream element of the RNA polymerase I promoter and forms a stable preinitiation complex. Together with SPT15/TBP UAF seems to stimulate basal transcription to a fully activated level.
Miscellaneous
Present with 524000 molecules/cell in log phase SD medium.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 17-21 | |||||
Sequence: KRHRK |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleosome | |
Cellular Component | nucleus | |
Cellular Component | replication fork protection complex | |
Cellular Component | RNA polymerase I upstream activating factor complex | |
Molecular Function | DNA binding | |
Molecular Function | identical protein binding | |
Molecular Function | protein heterodimerization activity | |
Molecular Function | structural constituent of chromatin | |
Biological Process | chromatin organization | |
Biological Process | nucleolar large rRNA transcription by RNA polymerase I | |
Biological Process | nucleosome assembly | |
Biological Process | positive regulation of transcription by RNA polymerase I | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHistone H4
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP02309
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 92 | Mimics glutarylation; delays in cell proliferation; increased sensitivity to DNA damaging agents. | ||||
Sequence: K → E | ||||||
Mutagenesis | 92 | Mimics acetylation; does not show increased sensitivity to DNA damaging agents. | ||||
Sequence: K → Q | ||||||
Mutagenesis | 92 | Mimics unmodified residue; does not show increased sensitivity to DNA damaging agents. | ||||
Sequence: K → R |
PTM/Processing
Features
Showing features for initiator methionine, chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Chain | PRO_0000158377 | 2-103 | Histone H4 | |||
Sequence: SGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG | ||||||
Modified residue | 6 | N6-acetyl-N6-methyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 6 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 6 | N6-methyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 9 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 9 | N6-butyryllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 9 | N6-methyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 13 | N6-acetyl-N6-methyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 13 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 13 | N6-butyryllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 13 | N6-methyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 17 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 32 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 56 | Omega-N-methylarginine | ||||
Sequence: R | ||||||
Modified residue | 61 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 65 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 78 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 80 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 92 | N6-glutaryllysine | ||||
Sequence: K |
Post-translational modification
Glutarylation at Lys-92 (H4K91glu) destabilizes nucleosomes by promoting dissociation of the H2A-H2B dimers from nucleosomes.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Histone H4 is a component of the UAF (upstream activation factor) complex which consists of UAF30, RRN5, RRN9, RRN10, and histones H3 and H4.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P02309 | ASF1 P32447 | 7 | EBI-8113, EBI-3003 | |
BINARY | P02309 | BDF1 P35817 | 3 | EBI-8113, EBI-3493 | |
BINARY | P02309 | ESA1 Q08649 | 5 | EBI-8113, EBI-6648 | |
BINARY | P02309 | FPR4 Q06205 | 5 | EBI-8113, EBI-6956 | |
BINARY | P02309 | HHF2 P02309 | 3 | EBI-8113, EBI-8113 | |
BINARY | P02309 | HHT2 P61830 | 12 | EBI-8113, EBI-8098 | |
BINARY | P02309 | HIF1 Q12373 | 7 | EBI-8113, EBI-31911 | |
XENO | P02309 | KAT8 Q9H7Z6 | 2 | EBI-8113, EBI-896414 | |
BINARY | P02309 | SET3 P36124 | 2 | EBI-8113, EBI-16993 | |
BINARY | P02309 | SET5 P38890 | 3 | EBI-8113, EBI-24263 | |
BINARY | P02309 | SNF2 P22082 | 2 | EBI-8113, EBI-17526 | |
BINARY | P02309 | STH1 P32597 | 6 | EBI-8113, EBI-18410 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-20 | Disordered | ||||
Sequence: MSGRGKGGKGLGKGGAKRHR |
Sequence similarities
Belongs to the histone H4 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length103
- Mass (Da)11,368
- Last updated2007-01-23 v2
- Checksum69B7D1F89E62DE41
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 46 | in Ref. 8; AA sequence | ||||
Sequence: R → K |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X00724 EMBL· GenBank· DDBJ | CAA25311.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X00725 EMBL· GenBank· DDBJ | CAA25313.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
K03154 EMBL· GenBank· DDBJ | AAA34660.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z35878 EMBL· GenBank· DDBJ | CAA84947.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z71306 EMBL· GenBank· DDBJ | CAA95892.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY692960 EMBL· GenBank· DDBJ | AAT92979.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006936 EMBL· GenBank· DDBJ | DAA07130.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006947 EMBL· GenBank· DDBJ | DAA10515.1 EMBL· GenBank· DDBJ | Genomic DNA |