P01374 · TNFB_HUMAN
- ProteinLymphotoxin-alpha
- GeneLTA
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids205 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM (PubMed:9462508).
In its heterotrimeric form with LTB binds to TNFRSF3/LTBR (PubMed:24248355).
Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo
In its heterotrimeric form with LTB binds to TNFRSF3/LTBR (PubMed:24248355).
Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameLymphotoxin-alpha
- Short namesLT-alpha
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP01374
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Involvement in disease
Psoriatic arthritis (PSORAS)
- Note
- DescriptionAn inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoid like pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis).
- See alsoMIM:607507
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_013023 | 13 | in dbSNP:rs2229094 | |||
Sequence: C → R | ||||||
Natural variant | VAR_013024 | 51 | in dbSNP:rs2229092 | |||
Sequence: H → P | ||||||
Natural variant | VAR_007511 | 60 | in allele TNFB*2; dbSNP:rs1041981 | |||
Sequence: T → N | ||||||
Natural variant | VAR_007512 | 125 | in allele 8.1 | |||
Sequence: T → P | ||||||
Mutagenesis | 142 | Reduces binding of LTA1-LTB2 to LTBR and LTBR-mediated NF-kappa-B signaling activation. Reduces binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with 'E-108'; 'R-109' and 'E-142' in LTB (subunit 1). Abolishes binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with 'E-108'; 'R-109'; 'E-142' and 'A-170' in LTB (subunit 1), and 'E-108'; 'R-109' and 'E-142' in LTB (subunit 2). | ||||
Sequence: Y → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 291 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-34 | |||||
Sequence: MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQG | ||||||
Chain | PRO_0000034463 | 35-205 | Lymphotoxin-alpha | |||
Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL | ||||||
Glycosylation | 41 | O-linked (GalNAc...) threonine; partial | ||||
Sequence: T | ||||||
Glycosylation | CAR_000048 | 96 | N-linked (GlcNAc...) asparagine | |||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Homotrimer, and heterotrimer of either two LTB and one LTA subunits or (less prevalent) two LTA and one LTB subunits (PubMed:9462508, PubMed:24248355).
Interacts with TNFRSF14 (PubMed:9462508).
Interacts with TNFRSF14 (PubMed:9462508).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P01374 | ABHD16A O95870 | 3 | EBI-524105, EBI-348517 | |
BINARY | P01374 | ANKRD40 Q6AI12 | 3 | EBI-524105, EBI-2838246 | |
BINARY | P01374 | ASPH Q12797-6 | 3 | EBI-524105, EBI-12092171 | |
BINARY | P01374 | SLC30A2 Q9BRI3 | 5 | EBI-524105, EBI-8644112 | |
BINARY | P01374 | TMEM237 Q96Q45-2 | 3 | EBI-524105, EBI-10982110 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 63-205 | THD | ||||
Sequence: PAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
Sequence similarities
Belongs to the tumor necrosis factor family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length205
- Mass (Da)22,297
- Last updated1989-07-01 v2
- Checksum1BBD5E7D496A3A82
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Polymorphism
A polymorphism in LTA accounts, in part, for susceptibility to leprosy linked to chromosome 6p21.3 (LPRS4) [MIM:610988].
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X01393 EMBL· GenBank· DDBJ | CAA25649.1 EMBL· GenBank· DDBJ | mRNA | ||
X02911 EMBL· GenBank· DDBJ | CAA26670.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
D00102 EMBL· GenBank· DDBJ | BAA00064.1 EMBL· GenBank· DDBJ | mRNA | ||
M16441 EMBL· GenBank· DDBJ | AAA61199.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
D12614 EMBL· GenBank· DDBJ | BAA02139.1 EMBL· GenBank· DDBJ | mRNA | ||
M55913 EMBL· GenBank· DDBJ | AAB59455.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z15026 EMBL· GenBank· DDBJ | CAA78746.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Y14768 EMBL· GenBank· DDBJ | CAA75071.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF129756 EMBL· GenBank· DDBJ | AAD18092.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BA000025 EMBL· GenBank· DDBJ | BAB63397.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY070490 EMBL· GenBank· DDBJ | AAL49956.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY216498 EMBL· GenBank· DDBJ | AAO21135.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC034729 EMBL· GenBank· DDBJ | AAH34729.1 EMBL· GenBank· DDBJ | mRNA |