P00771 · COGS_LEPPG
- ProteinBrachyurin
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids226 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
This enzyme is a serine protease capable of degrading the native triple helix of collagen.
Catalytic activity
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 41 | Charge relay system | ||||
Sequence: H | ||||||
Active site | 87 | Charge relay system | ||||
Sequence: D | ||||||
Active site | 178 | Charge relay system | ||||
Sequence: S |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | serine-type endopeptidase activity | |
Biological Process | collagen catabolic process | |
Biological Process | proteolysis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameBrachyurin
- EC number
- Alternative names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Crustacea > Multicrustacea > Malacostraca > Eumalacostraca > Eucarida > Decapoda > Pleocyemata > Brachyura > Eubrachyura > Ocypodoidea > Ocypodidae > Gelasiminae > Leptuca
Accessions
- Primary accessionP00771
PTM/Processing
Features
Showing features for chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000088664 | 1-226 | Brachyurin | |||
Sequence: IVGGVEAVPNSWPHQAALFIDDMYFCGGSLISPEWILTAAHCMDGAGFVDVVLGAHNIREDEATQVTIQSTDFTVHENYNSFVISNDIAVIRLPVPVTLTAAIATVGLPSTDVGVGTVVTPTGWGLPSDSALGISDVLRQVDVPIMSNADCDAVYGIVTDGNICIDSTGGKGTCNGDSGGPLNYNGLTYGITSFGAAAGCEAGYPDAFTRVTYFLDWIQTQTGITP | ||||||
Disulfide bond | 26↔42 | |||||
Sequence: CGGSLISPEWILTAAHC | ||||||
Disulfide bond | 151↔164 | |||||
Sequence: CDAVYGIVTDGNIC | ||||||
Disulfide bond | 174↔200 | |||||
Sequence: CNGDSGGPLNYNGLTYGITSFGAAAGC |
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-223 | Peptidase S1 | ||||
Sequence: IVGGVEAVPNSWPHQAALFIDDMYFCGGSLISPEWILTAAHCMDGAGFVDVVLGAHNIREDEATQVTIQSTDFTVHENYNSFVISNDIAVIRLPVPVTLTAAIATVGLPSTDVGVGTVVTPTGWGLPSDSALGISDVLRQVDVPIMSNADCDAVYGIVTDGNICIDSTGGKGTCNGDSGGPLNYNGLTYGITSFGAAAGCEAGYPDAFTRVTYFLDWIQTQTG |
Sequence similarities
Belongs to the peptidase S1 family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length226
- Mass (Da)23,511
- Last updated1998-07-15 v2
- ChecksumE45591CAF332CE8C
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 91 | in Ref. 1; AA sequence | ||||
Sequence: I → V | ||||||
Sequence conflict | 147-148 | in Ref. 1; AA sequence | ||||
Sequence: SN → NS | ||||||
Sequence conflict | 175 | in Ref. 1; AA sequence | ||||
Sequence: N → D | ||||||
Sequence conflict | 185 | in Ref. 1; AA sequence | ||||
Sequence: N → D |
Keywords
- Technical term