P00431 · CCPR_YEAST
- ProteinCytochrome c peroxidase, mitochondrial
- GeneCCP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids361 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Miscellaneous
Present with 6730 molecules/cell in log phase SD medium.
Catalytic activity
- 2 Fe(II)-[cytochrome c] + 2 H+ + H2O2 = 2 Fe(III)-[cytochrome c] + 2 H2O
Cofactor
Note: Binds 1 heme b (iron(II)-protoporphyrin IX) group per subunit.
Features
Showing features for site, active site, binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial intermembrane space | |
Cellular Component | mitochondrial matrix | |
Cellular Component | mitochondrion | |
Molecular Function | cytochrome-c peroxidase activity | |
Molecular Function | heme binding | |
Molecular Function | metal ion binding | |
Molecular Function | peroxidase activity | |
Biological Process | cellular response to oxidative stress | |
Biological Process | hydrogen peroxide catabolic process | |
Biological Process | response to reactive oxygen species |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCytochrome c peroxidase, mitochondrial
- EC number
- Short namesCCP
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP00431
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 33 | in allele 2 | ||||
Sequence: A → AA | ||||||
Natural variant | 120 | in allele 2 | ||||
Sequence: T → I | ||||||
Natural variant | 219 | in allele 2 | ||||
Sequence: D → G | ||||||
Mutagenesis | 258 | Substantially diminished activity. | ||||
Sequence: W → F |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 5 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-67 | Mitochondrion | ||||
Sequence: MTTAVRLLPSLGRTAHKRSLYLFSAAAAAAAAATFAYSQSQKRSSSSPGGGSNHGWNNWGKAAALAS | ||||||
Chain | PRO_0000023634 | 68-361 | Cytochrome c peroxidase, mitochondrial | |||
Sequence: TTPLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL | ||||||
Modified residue | 220 | Phosphotyrosine | ||||
Sequence: Y |
Post-translational modification
CCP1 precursor is processed by the rhomboid protease PCP1, which cleaves the N-terminal hydrophobic transit peptide (PubMed:12774122, PubMed:17245427).
The m-AAA protease (composed of YTA12/RCA1 and YTA10/AFG3) is required for CCP1 maturation: m-AAA protease promotes membrane dislocation of the CCP1 transmembrane segment within the transit peptide to ensure the correct positioning of CCP1 within the membrane bilayer, allowing intramembrane cleavage by PCP1 (PubMed:17245427).
The m-AAA protease (composed of YTA12/RCA1 and YTA10/AFG3) is required for CCP1 maturation: m-AAA protease promotes membrane dislocation of the CCP1 transmembrane segment within the transit peptide to ensure the correct positioning of CCP1 within the membrane bilayer, allowing intramembrane cleavage by PCP1 (PubMed:17245427).
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Forms a one-to-one complex with cytochrome c.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P00431 | CYC1 P00044 | 4 | EBI-4389, EBI-5393 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length361
- Mass (Da)40,353
- Last updated1994-06-01 v2
- ChecksumA5D26385DA6F0A0B
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 41 | in Ref. 3; AAA88709 | ||||
Sequence: Q → H | ||||||
Sequence conflict | 62 | in Ref. 3; AAA88709 | ||||
Sequence: A → P | ||||||
Sequence conflict | 145-146 | in Ref. 6; AA sequence | ||||
Sequence: ND → DN | ||||||
Sequence conflict | 231 | in Ref. 6; AA sequence | ||||
Sequence: Missing | ||||||
Sequence conflict | 273 | in Ref. 5; AAS56247 | ||||
Sequence: L → M |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
J01468 EMBL· GenBank· DDBJ | AAA88709.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X62422 EMBL· GenBank· DDBJ | CAA44288.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z28291 EMBL· GenBank· DDBJ | CAA82145.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY557921 EMBL· GenBank· DDBJ | AAS56247.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
J01321 EMBL· GenBank· DDBJ | AAA88710.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006944 EMBL· GenBank· DDBJ | DAA09217.1 EMBL· GenBank· DDBJ | Genomic DNA |