O95983 · MBD3_HUMAN
- ProteinMethyl-CpG-binding domain protein 3
- GeneMBD3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids291 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as a component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin (PubMed:12124384, PubMed:16428440, PubMed:28977666).
Acts as transcriptional repressor and plays a role in gene silencing (PubMed:10947852, PubMed:18644863).
Does not bind to methylated DNA by itself (PubMed:12124384, PubMed:16428440).
Binds to a lesser degree DNA containing unmethylated CpG dinucleotides (PubMed:24307175).
Recruits histone deacetylases and DNA methyltransferases
Acts as transcriptional repressor and plays a role in gene silencing (PubMed:10947852, PubMed:18644863).
Does not bind to methylated DNA by itself (PubMed:12124384, PubMed:16428440).
Binds to a lesser degree DNA containing unmethylated CpG dinucleotides (PubMed:24307175).
Recruits histone deacetylases and DNA methyltransferases
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | cytoplasm | |
Cellular Component | heterochromatin | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | NuRD complex | |
Cellular Component | protein-containing complex | |
Molecular Function | DNA binding | |
Molecular Function | methyl-CpG binding | |
Biological Process | chromatin remodeling | |
Biological Process | DNA methylation-dependent heterochromatin formation | |
Biological Process | embryonic organ development | |
Biological Process | in utero embryonic development | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | regulation of cell fate specification | |
Biological Process | regulation of stem cell differentiation | |
Biological Process | response to estradiol | |
Biological Process | response to nutrient levels | |
Biological Process | ventricular cardiac muscle tissue development |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMethyl-CpG-binding domain protein 3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO95983
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Nuclear, in discrete foci. Detected on chromatin, at promoter regions of active genes.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 30 | No effect. Confers strong binding to methylated CpG (in vitro); when associated with Y-34. | ||||
Sequence: H → K | ||||||
Mutagenesis | 34 | Augments DNA binding activity, irrespective of DNA methylation. | ||||
Sequence: F → A | ||||||
Mutagenesis | 34 | Confers weak binding to methylated CpG (in vitro). Confers strong binding to methylated CpG (in vitro); when associated with K-30. | ||||
Sequence: F → Y |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 338 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue, cross-link.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000096262 | 1-291 | UniProt | Methyl-CpG-binding domain protein 3 | |||
Sequence: MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV | |||||||
Modified residue (large scale data) | 37 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 56 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 56 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 73 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 85 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 85 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 86 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 90 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 92 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 144 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 144 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Heterodimer (via N-terminus) with MBD2 (PubMed:10947852, PubMed:15701600).
Component of the MeCP1 histone deacetylase complex (PubMed:11756549, PubMed:12124384).
Component of the nucleosome remodeling and deacetylase (NuRD) repressor complex, composed of core proteins MTA1, MTA2, MTA3, RBBP4, RBBP7, HDAC1, HDAC2, MBD2, MBD3, and peripherally associated proteins CDK2AP1, CDK2AP2, GATAD2A, GATAD2B, CHD3, CHD4 and CHD5 (PubMed:12124384, PubMed:15454082, PubMed:16428440, PubMed:27732854, PubMed:28977666, PubMed:33283408).
The exact stoichiometry of the NuRD complex is unknown, and some subunits such as MBD2 and MBD3, GATAD2A and GATAD2B, and CHD3, CHD4 and CHD5 define mutually exclusive NuRD complexes (PubMed:16428440, PubMed:27732854, PubMed:28977666, PubMed:33283408).
Interacts with MBD3L2 (via N-terminus); the interaction is direct (PubMed:15701600).
Interacts with BCL6 (PubMed:15454082).
Interacts with CDK2AP1 (PubMed:20523938).
Interacts with HDAC1 (PubMed:12124384).
Interacts with MTA2 (PubMed:12124384).
Interacts with DNMT1 (PubMed:10947852).
Interacts with GATAD2A (PubMed:12183469, PubMed:27732854).
Interacts with GATAD2B (PubMed:11756549, PubMed:12183469, PubMed:27732854).
Does not interact with PWWP2A (By similarity).
Does not interact with PWWP2B (By similarity).
Component of the MeCP1 histone deacetylase complex (PubMed:11756549, PubMed:12124384).
Component of the nucleosome remodeling and deacetylase (NuRD) repressor complex, composed of core proteins MTA1, MTA2, MTA3, RBBP4, RBBP7, HDAC1, HDAC2, MBD2, MBD3, and peripherally associated proteins CDK2AP1, CDK2AP2, GATAD2A, GATAD2B, CHD3, CHD4 and CHD5 (PubMed:12124384, PubMed:15454082, PubMed:16428440, PubMed:27732854, PubMed:28977666, PubMed:33283408).
The exact stoichiometry of the NuRD complex is unknown, and some subunits such as MBD2 and MBD3, GATAD2A and GATAD2B, and CHD3, CHD4 and CHD5 define mutually exclusive NuRD complexes (PubMed:16428440, PubMed:27732854, PubMed:28977666, PubMed:33283408).
Interacts with MBD3L2 (via N-terminus); the interaction is direct (PubMed:15701600).
Interacts with BCL6 (PubMed:15454082).
Interacts with CDK2AP1 (PubMed:20523938).
Interacts with HDAC1 (PubMed:12124384).
Interacts with MTA2 (PubMed:12124384).
Interacts with DNMT1 (PubMed:10947852).
Interacts with GATAD2A (PubMed:12183469, PubMed:27732854).
Interacts with GATAD2B (PubMed:11756549, PubMed:12183469, PubMed:27732854).
Does not interact with PWWP2A (By similarity).
Does not interact with PWWP2B (By similarity).
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, coiled coil, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-72 | MBD | ||||
Sequence: MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMS | ||||||
Region | 1-80 | Required for interaction with MBD2 | ||||
Sequence: MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQR | ||||||
Region | 60-80 | Required for interaction with MBD3L2 | ||||
Sequence: STFDFRTGKMLMSKMNKSRQR | ||||||
Coiled coil | 216-245 | |||||
Sequence: KAFMVTDEDIRKQEELVQQVRKRLEEALMA | ||||||
Region | 254-291 | Disordered | ||||
Sequence: LARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV | ||||||
Compositional bias | 264-291 | Acidic residues | ||||
Sequence: KACAEDDDEEDEEEEEEEPDPDPEMEHV |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
O95983-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length291
- Mass (Da)32,844
- Last updated1999-05-01 v1
- ChecksumB62134DD1BEB636B
O95983-2
- Name2
- Differences from canonical
- 5-36: Missing
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
K7EIE8 | K7EIE8_HUMAN | MBD3 | 235 | ||
A0A0A0MTS6 | A0A0A0MTS6_HUMAN | MBD3 | 185 | ||
A0A087X1H1 | A0A087X1H1_HUMAN | MBD3 | 147 | ||
A0A087WT34 | A0A087WT34_HUMAN | MBD3 | 130 | ||
A0A087WVG6 | A0A087WVG6_HUMAN | MBD3 | 41 | ||
A0A087WZ12 | A0A087WZ12_HUMAN | MBD3 | 34 |
Sequence caution
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_011081 | 5-36 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 264-291 | Acidic residues | ||||
Sequence: KACAEDDDEEDEEEEEEEPDPDPEMEHV |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF072247 EMBL· GenBank· DDBJ | AAC68876.1 EMBL· GenBank· DDBJ | mRNA | ||
AK290882 EMBL· GenBank· DDBJ | BAF83571.1 EMBL· GenBank· DDBJ | mRNA | ||
AC005943 EMBL· GenBank· DDBJ | AAC72104.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471139 EMBL· GenBank· DDBJ | EAW69477.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471139 EMBL· GenBank· DDBJ | EAW69478.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471139 EMBL· GenBank· DDBJ | EAW69481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC009372 EMBL· GenBank· DDBJ | AAH09372.1 EMBL· GenBank· DDBJ | mRNA | ||
BC009438 EMBL· GenBank· DDBJ | AAH09438.1 EMBL· GenBank· DDBJ | mRNA | ||
BC032443 EMBL· GenBank· DDBJ | AAH32443.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BC043619 EMBL· GenBank· DDBJ | AAH43619.1 EMBL· GenBank· DDBJ | mRNA |