O95858 · TSN15_HUMAN
- ProteinTetraspanin-15
- GeneTSPAN15
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids294 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Part of TspanC8 subgroup, composed of 6 members that interact with the transmembrane metalloprotease ADAM10. This interaction is required for ADAM10 exit from the endoplasmic reticulum and for enzymatic maturation and trafficking to the cell surface as well as substrate specificity. Different TspanC8/ADAM10 complexes have distinct substrates (PubMed:26686862, PubMed:30463011, PubMed:31792032, PubMed:34739841).
Promotes ADAM10-mediated cleavage of CDH2 (PubMed:34739841).
Negatively regulates ligand-induced Notch activity probably by regulating ADAM10 activity (PubMed:26686862, PubMed:31792032).
Promotes ADAM10-mediated cleavage of CDH2 (PubMed:34739841).
Negatively regulates ligand-induced Notch activity probably by regulating ADAM10 activity (PubMed:26686862, PubMed:31792032).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell junction | |
Cellular Component | cell surface | |
Cellular Component | cytosol | |
Cellular Component | endoplasmic reticulum lumen | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | late endosome membrane | |
Cellular Component | nuclear body | |
Cellular Component | plasma membrane | |
Cellular Component | tetraspanin-enriched microdomain | |
Molecular Function | enzyme binding | |
Biological Process | negative regulation of Notch signaling pathway | |
Biological Process | protein localization to plasma membrane | |
Biological Process | protein maturation | |
Biological Process | regulation of membrane protein ectodomain proteolysis |
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameTetraspanin-15
- Short namesTspan-15
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO95858
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-23 | Cytoplasmic | ||||
Sequence: MPRGDSEQVRYCARFSYLWLKFS | ||||||
Transmembrane | 24-44 | Helical | ||||
Sequence: LIIYSTVFWLIGALVLSVGIY | ||||||
Topological domain | 45-62 | Extracellular | ||||
Sequence: AEVERQKYKTLESAFLAP | ||||||
Transmembrane | 63-83 | Helical | ||||
Sequence: AIILILLGVVMFMVSFIGVLA | ||||||
Topological domain | 84-93 | Cytoplasmic | ||||
Sequence: SLRDNLYLLQ | ||||||
Transmembrane | 94-114 | Helical | ||||
Sequence: AFMYILGICLIMELIGGVVAL | ||||||
Topological domain | 115-235 | Extracellular | ||||
Sequence: TFRNQTIDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTTEVVNTMCGYKTIDKERFSVQDVIYVRGCTNAVIIWFMDNYTIMA | ||||||
Transmembrane | 236-256 | Helical | ||||
Sequence: GILLGILLPQFLGVLLTLLYI | ||||||
Topological domain | 257-294 | Cytoplasmic | ||||
Sequence: TRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 166-169 | Alsmost abolishes interaction with ADAM10. Decreases maturation of ADAM10 and CDH2/N-cadherin cleavage. | ||||
Sequence: NQYH → AQAA | ||||||
Mutagenesis | 193-196 | No effect on interaction with ADAM10. Decreases maturation of ADAM10. No effect on CDH2/N-cadherin cleavage. | ||||
Sequence: VVNT → AVAA | ||||||
Mutagenesis | 204-206 | No effect on interaction with ADAM10. No effect on maturation of ADAM10. No effect on CDH2/N-cadherin cleavage. | ||||
Sequence: DKE → AAA | ||||||
Mutagenesis | 288-291 | Strongly reduces palmitoylation levels. | ||||
Sequence: CCLC → AALA |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 300 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000219263 | 1-294 | Tetraspanin-15 | |||
Sequence: MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGALVLSVGIYAEVERQKYKTLESAFLAPAIILILLGVVMFMVSFIGVLASLRDNLYLLQAFMYILGICLIMELIGGVVALTFRNQTIDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTTEVVNTMCGYKTIDKERFSVQDVIYVRGCTNAVIIWFMDNYTIMAGILLGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN | ||||||
Glycosylation | 118 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 154↔219 | |||||
Sequence: CCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTTEVVNTMCGYKTIDKERFSVQDVIYVRGC | ||||||
Disulfide bond | 155↔185 | |||||
Sequence: CGGEDYRDWSKNQYHDCSAPGPLACGVPYTC | ||||||
Disulfide bond | 171↔179 | |||||
Sequence: CSAPGPLAC | ||||||
Disulfide bond | 186↔198 | |||||
Sequence: CIRNTTEVVNTMC | ||||||
Glycosylation | 189 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 230 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Palmitoylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with ADAM10; the interaction influences ADAM10 substrate specificity, endocytosis and turnover.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O95858 | ADAM10 O14672 | 11 | EBI-7361096, EBI-1536151 | |
BINARY | O95858 | GYPC P04921 | 3 | EBI-7361096, EBI-7797098 | |
BINARY | O95858 | STRIT1 P0DN84 | 3 | EBI-7361096, EBI-12200293 | |
BINARY | O95858 | SYNE4 Q8N205 | 3 | EBI-7361096, EBI-7131783 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length294
- Mass (Da)33,165
- Last updated1999-05-01 v1
- Checksum71A6DC64D6CA6BAE
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H7C285 | H7C285_HUMAN | TSPAN15 | 160 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 236 | in Ref. 2; AAQ89293 | ||||
Sequence: G → C |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF120266 EMBL· GenBank· DDBJ | AAD17295.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358934 EMBL· GenBank· DDBJ | AAQ89293.1 EMBL· GenBank· DDBJ | mRNA | ||
BC003157 EMBL· GenBank· DDBJ | AAH03157.1 EMBL· GenBank· DDBJ | mRNA | ||
BC004161 EMBL· GenBank· DDBJ | AAH04161.1 EMBL· GenBank· DDBJ | mRNA |