O95371 · OR2C1_HUMAN
- ProteinOlfactory receptor 2C1
- GeneOR2C1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids312 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Olfactory receptor that is activated by the binding of organosulfur odorants with thioether groups such as (methylthio)methanetiol (MTMT) (By similarity).
Also binds odorants acetophenone and benzaldehyde (By similarity).
The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (By similarity).
May be involved in the molecular processes underlying fasciculation and targeting of olfactory axons (By similarity).
Also binds odorants acetophenone and benzaldehyde (By similarity).
The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (By similarity).
May be involved in the molecular processes underlying fasciculation and targeting of olfactory axons (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell cortex | |
Cellular Component | plasma membrane | |
Molecular Function | G protein-coupled receptor activity | |
Molecular Function | odorant binding | |
Molecular Function | olfactory receptor activity | |
Biological Process | detection of chemical stimulus involved in sensory perception of smell |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameOlfactory receptor 2C1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO95371
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-25 | Extracellular | ||||
Sequence: MDGVNDSSLQGFVLMGISDHPQLEM | ||||||
Transmembrane | 26-49 | Helical; Name=1 | ||||
Sequence: IFFIAILFSYLLTLLGNSTIILLS | ||||||
Topological domain | 50-57 | Cytoplasmic | ||||
Sequence: RLEARLHT | ||||||
Transmembrane | 58-79 | Helical; Name=2 | ||||
Sequence: PMYFFLSNLSSLDLAFATSSVP | ||||||
Topological domain | 80-100 | Extracellular | ||||
Sequence: QMLINLWGPGKTISYGGCITQ | ||||||
Transmembrane | 101-120 | Helical; Name=3 | ||||
Sequence: LYVFLWLGATECILLVVMAF | ||||||
Topological domain | 121-139 | Cytoplasmic | ||||
Sequence: DRYVAVCRPLRYTAIMNPQ | ||||||
Transmembrane | 140-158 | Helical; Name=4 | ||||
Sequence: LCWLLAVIACLGGLGNSVI | ||||||
Topological domain | 159-196 | Extracellular | ||||
Sequence: QSTFTLQLPLCGHRRVEGFLCEVPAMIKLACGDTSLNQ | ||||||
Transmembrane | 197-219 | Helical; Name=5 | ||||
Sequence: AVLNGVCTFFTAVPLSIIVISYC | ||||||
Topological domain | 220-236 | Cytoplasmic | ||||
Sequence: LIAQAVLKIRSAEGRRK | ||||||
Transmembrane | 237-259 | Helical; Name=6 | ||||
Sequence: AFNTCLSHLLVVFLFYGSASYGY | ||||||
Topological domain | 260-272 | Extracellular | ||||
Sequence: LLPAKNSKQDQGK | ||||||
Transmembrane | 273-292 | Helical; Name=7 | ||||
Sequence: FISLFYSLVTPMVNPLIYTL | ||||||
Topological domain | 293-312 | Cytoplasmic | ||||
Sequence: RNMEVKGALRRLLGKGREVG |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_047490 | 16 | in dbSNP:rs1218762 | |||
Sequence: G → S | ||||||
Natural variant | VAR_047491 | 149 | in dbSNP:rs1218763 | |||
Sequence: C → W | ||||||
Natural variant | VAR_047492 | 229 | in dbSNP:rs11648783 | |||
Sequence: R → H |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 429 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000150465 | 1-312 | Olfactory receptor 2C1 | |||
Sequence: MDGVNDSSLQGFVLMGISDHPQLEMIFFIAILFSYLLTLLGNSTIILLSRLEARLHTPMYFFLSNLSSLDLAFATSSVPQMLINLWGPGKTISYGGCITQLYVFLWLGATECILLVVMAFDRYVAVCRPLRYTAIMNPQLCWLLAVIACLGGLGNSVIQSTFTLQLPLCGHRRVEGFLCEVPAMIKLACGDTSLNQAVLNGVCTFFTAVPLSIIVISYCLIAQAVLKIRSAEGRRKAFNTCLSHLLVVFLFYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGALRRLLGKGREVG | ||||||
Glycosylation | 5 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 97↔189 | |||||
Sequence: CITQLYVFLWLGATECILLVVMAFDRYVAVCRPLRYTAIMNPQLCWLLAVIACLGGLGNSVIQSTFTLQLPLCGHRRVEGFLCEVPAMIKLAC |
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length312
- Mass (Da)34,412
- Last updated2010-11-02 v3
- Checksum33A2697D06ED8E9E
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF098664 EMBL· GenBank· DDBJ | AAC83557.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC025283 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471112 EMBL· GenBank· DDBJ | EAW85373.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC069456 EMBL· GenBank· DDBJ | AAH69456.1 EMBL· GenBank· DDBJ | mRNA | ||
BC126269 EMBL· GenBank· DDBJ | AAI26270.1 EMBL· GenBank· DDBJ | mRNA | ||
BC130328 EMBL· GenBank· DDBJ | AAI30329.1 EMBL· GenBank· DDBJ | mRNA | ||
BK004407 EMBL· GenBank· DDBJ | DAA04805.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK004428 EMBL· GenBank· DDBJ | DAA04826.1 EMBL· GenBank· DDBJ | Genomic DNA |