O95238 · SPDEF_HUMAN
- ProteinSAM pointed domain-containing Ets transcription factor
- GeneSPDEF
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids335 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May function as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter. Binds to 5'-GGAT-3' DNA sequences. May play a role in the regulation of the prostate gland and/or prostate cancer development. Acts as a transcriptional activator for SERPINB5 promoter.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 249-332 | ETS | ||||
Sequence: IHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFV |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | sequence-specific DNA binding | |
Molecular Function | sequence-specific double-stranded DNA binding | |
Biological Process | epithelial cell fate commitment | |
Biological Process | glandular epithelial cell development | |
Biological Process | intestinal epithelial cell development | |
Biological Process | lung goblet cell differentiation | |
Biological Process | negative regulation of cell fate commitment | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of apoptotic process | |
Biological Process | positive regulation of cell fate commitment | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSAM pointed domain-containing Ets transcription factor
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO95238
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_048955 | 57 | in dbSNP:rs2233639 | |||
Sequence: A → T |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 379 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000223958 | 1-335 | UniProt | SAM pointed domain-containing Ets transcription factor | |||
Sequence: MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI | |||||||
Modified residue (large scale data) | 3 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 12 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in a very restricted set of primarily hormone-regulated epithelial tissues with particularly high expression in the prostate gland. Significantly lower expression is seen in other hormone regulated tissues such as mammary gland, salivary gland, and ovary. Expressed in prostate carcinoma cells.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with the DNA-binding domain of the androgen receptor. Interacts with NKX3-1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O95238 | BRK1 Q8WUW1 | 3 | EBI-12811275, EBI-2837444 | |
BINARY | O95238 | CEP57 Q86XR8-3 | 3 | EBI-12811275, EBI-11752486 | |
BINARY | O95238 | COX5A P20674 | 3 | EBI-12811275, EBI-715032 | |
BINARY | O95238 | ENKD1 Q9H0I2 | 3 | EBI-12811275, EBI-744099 | |
BINARY | O95238 | FAM161B Q96MY7 | 3 | EBI-12811275, EBI-7225287 | |
BINARY | O95238 | PSMA1 P25786 | 3 | EBI-12811275, EBI-359352 | |
BINARY | O95238 | SNX20 Q7Z614-3 | 3 | EBI-12811275, EBI-12336127 | |
BINARY | O95238 | TTC23 Q5W5X9-3 | 3 | EBI-12811275, EBI-9090990 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-19 | Polar residues | ||||
Sequence: MGSASPGLSSVSPSHLLLP | ||||||
Region | 1-25 | Disordered | ||||
Sequence: MGSASPGLSSVSPSHLLLPPDTVSR | ||||||
Region | 75-100 | Disordered | ||||
Sequence: AKAPGASSREEPPEEPEQCPVIDSQA | ||||||
Domain | 129-213 | PNT | ||||
Sequence: EVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAA |
Sequence similarities
Belongs to the ETS family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
O95238-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length335
- Mass (Da)37,518
- Last updated1999-05-01 v1
- ChecksumD3117E1AEEBA95EC
O95238-2
- Name2
- Differences from canonical
- 212-227: Missing
Features
Showing features for compositional bias, sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-19 | Polar residues | ||||
Sequence: MGSASPGLSSVSPSHLLLP | ||||||
Sequence conflict | 49 | in Ref. 3; BAG63040 | ||||
Sequence: A → G | ||||||
Sequence conflict | 76 | in Ref. 3; BAG63040 | ||||
Sequence: K → N | ||||||
Alternative sequence | VSP_044722 | 212-227 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB031549 EMBL· GenBank· DDBJ | BAA89543.1 EMBL· GenBank· DDBJ | mRNA | ||
AF071538 EMBL· GenBank· DDBJ | AAC95296.1 EMBL· GenBank· DDBJ | mRNA | ||
AK301543 EMBL· GenBank· DDBJ | BAG63040.1 EMBL· GenBank· DDBJ | mRNA | ||
BX255971 EMBL· GenBank· DDBJ | CAI23605.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL157372 EMBL· GenBank· DDBJ | CAI23605.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX255972 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BX255973 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC021299 EMBL· GenBank· DDBJ | AAH21299.1 EMBL· GenBank· DDBJ | mRNA |