O95229 · ZWINT_HUMAN
- ProteinZW10 interactor
- GeneZWINT
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids277 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Part of the MIS12 complex, which is required for kinetochore formation and spindle checkpoint activity. Required to target ZW10 to the kinetochore at prometaphase.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | dendrite | |
Cellular Component | kinetochore | |
Cellular Component | Knl1/Spc105 complex | |
Cellular Component | nuclear body | |
Cellular Component | nucleoplasm | |
Cellular Component | outer kinetochore | |
Biological Process | cell division | |
Biological Process | establishment of localization in cell | |
Biological Process | homologous chromosome orientation in meiotic metaphase I | |
Biological Process | mitotic sister chromatid segregation | |
Biological Process | mitotic spindle assembly checkpoint signaling | |
Biological Process | regulation of meiosis I spindle assembly checkpoint |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameZW10 interactor
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO95229
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to kinetochores from late prophase to anaphase.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_028783 | 4 | in dbSNP:rs11005328 | |||
Sequence: A → S | ||||||
Natural variant | VAR_051505 | 187 | in dbSNP:rs2241666 | |||
Sequence: R → G |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 415 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000066594 | 1-277 | UniProt | ZW10 interactor | |||
Sequence: MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDRVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP | |||||||
Modified residue (large scale data) | 81 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with ZW10 and MIS12. Interacts with the NDC80 subunit of the NDC80 complex specifically during mitosis. Also interacts with KNL1, CETN3, DSN1 and PMF1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O95229 | BCAS2 O75934 | 3 | EBI-1001132, EBI-1050106 | |
BINARY | O95229 | BECN1 Q14457 | 6 | EBI-1001132, EBI-949378 | |
BINARY | O95229 | BFSP1 Q12934-2 | 3 | EBI-1001132, EBI-12123320 | |
BINARY | O95229 | CCHCR1 Q8TD31-3 | 3 | EBI-1001132, EBI-10175300 | |
BINARY | O95229 | FAM90A1 Q86YD7 | 3 | EBI-1001132, EBI-6658203 | |
BINARY | O95229 | KLF11 O14901 | 3 | EBI-1001132, EBI-948266 | |
BINARY | O95229 | KRT75 O95678 | 3 | EBI-1001132, EBI-2949715 | |
BINARY | O95229 | MSGN1 A6NI15 | 3 | EBI-1001132, EBI-11991020 | |
BINARY | O95229 | NDC80 O14777 | 16 | EBI-1001132, EBI-715849 | |
BINARY | O95229 | NUP54 Q7Z3B4 | 3 | EBI-1001132, EBI-741048 | |
BINARY | O95229 | NUP58 Q9BVL2 | 3 | EBI-1001132, EBI-2811583 | |
BINARY | O95229 | PCOLCE2 Q9UKZ9 | 2 | EBI-1001132, EBI-20737478 | |
BINARY | O95229 | TSG101 Q99816 | 3 | EBI-1001132, EBI-346882 | |
BINARY | O95229 | ZW10 O43264 | 6 | EBI-1001132, EBI-1001217 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, coiled coil, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 80-155 | Interaction with NDC80 and ZW10 | ||||
Sequence: ASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQ | ||||||
Coiled coil | 104-217 | |||||
Sequence: REHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDRVFQKLGNLKQQAEQERDKLQRYQTFLQLLY | ||||||
Region | 228-277 | Disordered | ||||
Sequence: AEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP | ||||||
Compositional bias | 240-256 | Polar residues | ||||
Sequence: PQQPTRPQEQSTGDTMG |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
O95229-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length277
- Mass (Da)31,293
- Last updated2006-10-31 v2
- Checksum3335FBA5731AD0DC
O95229-2
- Name2
- Differences from canonical
- 174-220: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_047660 | 174-220 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 240-256 | Polar residues | ||||
Sequence: PQQPTRPQEQSTGDTMG |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF067656 EMBL· GenBank· DDBJ | AAC78629.1 EMBL· GenBank· DDBJ | mRNA | ||
AC010996 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC000411 EMBL· GenBank· DDBJ | AAH00411.1 EMBL· GenBank· DDBJ | mRNA | ||
BC020979 EMBL· GenBank· DDBJ | AAH20979.1 EMBL· GenBank· DDBJ | mRNA | ||
BC110399 EMBL· GenBank· DDBJ | AAI10400.1 EMBL· GenBank· DDBJ | mRNA |