O95219 · SNX4_HUMAN
- ProteinSorting nexin-4
- GeneSNX4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids450 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the regulation of endocytosis and in several stages of intracellular trafficking (PubMed:12668730, PubMed:17994011, PubMed:32513819, PubMed:33468622).
Plays a role in recycling endocytosed transferrin receptor and prevent its degradation (PubMed:17994011).
Involved in autophagosome assembly by regulating trafficking and recycling of phospholipid scramblase ATG9A (PubMed:32513819, PubMed:33468622).
Plays a role in recycling endocytosed transferrin receptor and prevent its degradation (PubMed:17994011).
Involved in autophagosome assembly by regulating trafficking and recycling of phospholipid scramblase ATG9A (PubMed:32513819, PubMed:33468622).
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 106 | a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 108 | a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 132 | a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 154 | a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) (UniProtKB | ChEBI) | ||||
Sequence: R |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoplasmic dynein complex | |
Cellular Component | early endosome | |
Cellular Component | early endosome membrane | |
Cellular Component | membrane | |
Cellular Component | plasma membrane | |
Cellular Component | presynaptic endosome | |
Cellular Component | protein-containing complex | |
Cellular Component | SNARE complex | |
Molecular Function | epidermal growth factor receptor binding | |
Molecular Function | insulin receptor binding | |
Molecular Function | leptin receptor binding | |
Molecular Function | phosphatidylinositol binding | |
Molecular Function | phosphatidylinositol-3-phosphate binding | |
Molecular Function | transferrin receptor binding | |
Biological Process | endocytic recycling | |
Biological Process | positive regulation of autophagosome assembly | |
Biological Process | positive regulation of histamine secretion by mast cell | |
Biological Process | protein transport |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSorting nexin-4
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO95219
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Early endosome membrane ; Peripheral membrane protein
Note: Also detected on a juxtanuclear endocytic recycling compartment (ERC).
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 132 | Abolishes phosphatidylinositol phosphate binding. Abolishes endosomal location. | ||||
Sequence: K → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 471 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue | 1 | UniProt | N-acetylmethionine | ||||
Sequence: M | |||||||
Chain | PRO_0000213842 | 1-450 | UniProt | Sorting nexin-4 | |||
Sequence: MEQAPPDPERQLQPAPLEPLGSPDAGLGAAVGKEAEGAGEESSGVDTMTHNNFWLKKIEISVSEAEKRTGRNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVYYPHIVVPPLPEKRAEFVWHKLSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLFLTQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKHYSDELQSVISHLLRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHYADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKEALISYAVMQISMCKKGIQVWTNAKECFSKM | |||||||
Modified residue | 22 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 22 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 108 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Heterodimer; heterodimerizes with SNX7 or SNX30 (PubMed:32513819).
Interacts with WWC1/KIBRA (PubMed:17994011).
Identified in a complex with WWC1/KIBRA and dynein components DYNLL1 and DYNC1I2 (PubMed:17994011).
Interacts with BIN1 (PubMed:12668730).
Interacts with WWC1/KIBRA (PubMed:17994011).
Identified in a complex with WWC1/KIBRA and dynein components DYNLL1 and DYNC1I2 (PubMed:17994011).
Interacts with BIN1 (PubMed:12668730).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O95219 | ARL6IP1 Q15041 | 3 | EBI-724909, EBI-714543 | |
BINARY | O95219 | BIN1 O00499 | 4 | EBI-724909, EBI-719094 | |
BINARY | O95219 | DGAT2L6 Q6ZPD8 | 3 | EBI-724909, EBI-12831978 | |
BINARY | O95219 | MAGEA6 P43360 | 3 | EBI-724909, EBI-1045155 | |
BINARY | O95219 | SH3GLB1 Q9Y371 | 3 | EBI-724909, EBI-2623095 | |
BINARY | O95219 | SNX30 Q5VWJ9 | 6 | EBI-724909, EBI-8099676 | |
BINARY | O95219 | SNX7 Q9UNH6 | 6 | EBI-724909, EBI-751422 | |
BINARY | O95219 | SNX7 Q9UNH6-3 | 4 | EBI-724909, EBI-12424584 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-46 | Disordered | ||||
Sequence: MEQAPPDPERQLQPAPLEPLGSPDAGLGAAVGKEAEGAGEESSGVD | ||||||
Domain | 61-187 | PX | ||||
Sequence: SVSEAEKRTGRNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVYYPHIVVPPLPEKRAEFVWHKLSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLFLTQEGNW |
Domain
The PX domain binds phosphatidylinositol 3-phosphate which is necessary for peripheral membrane localization.
Sequence similarities
Belongs to the sorting nexin family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
O95219-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length450
- Mass (Da)51,909
- Last updated1999-05-01 v1
- Checksum3D5B52AC52A07686
O95219-2
- Name2
- Differences from canonical
- 1-145: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_056665 | 1-145 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF065485 EMBL· GenBank· DDBJ | AAC83149.1 EMBL· GenBank· DDBJ | mRNA | ||
AK001835 EMBL· GenBank· DDBJ | BAG50982.1 EMBL· GenBank· DDBJ | mRNA | ||
AK298972 EMBL· GenBank· DDBJ | BAG61066.1 EMBL· GenBank· DDBJ | mRNA | ||
AC080096 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC117487 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471052 EMBL· GenBank· DDBJ | EAW79390.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471052 EMBL· GenBank· DDBJ | EAW79391.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471052 EMBL· GenBank· DDBJ | EAW79393.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC018762 EMBL· GenBank· DDBJ | AAH18762.1 EMBL· GenBank· DDBJ | mRNA |