O95201 · RHIT_HUMAN
- ProteinTranscriptional repressor RHIT
- GeneZNF205
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids554 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcriptional repressor involved in regulating MPV17L expression (PubMed:22306510).
By regulating MPV17L expression, contributes to the regulation of genes involved in H2O2 metabolism and the mitochondrial apoptotic cascade (PubMed:22306510).
By regulating MPV17L expression, contributes to the regulation of genes involved in H2O2 metabolism and the mitochondrial apoptotic cascade (PubMed:22306510).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription repressor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | zinc ion binding | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of hydrogen peroxide biosynthetic process | |
Biological Process | positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscriptional repressor RHIT
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO95201
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_028798 | 43 | in dbSNP:rs909410 | |||
Sequence: T → A | ||||||
Natural variant | VAR_028799 | 255 | in dbSNP:rs12445220 | |||
Sequence: A → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 840 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), cross-link, modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000047451 | 1-554 | UniProt | Transcriptional repressor RHIT | |||
Sequence: MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDTQESLHIKMEPEEPHSEGASQEDGAQGAWGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWSQMPVTFEDVALYLSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASGSSRQAGDEKEWRGACTGAVEVGQRVQTSSVAALGNVKPFRTRAGRVQWGVPQCAQEAACGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPEKPNEEEKGAPESGEEGLAPDSEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTGEKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPHKCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSHLTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPAPT | |||||||
Modified residue (large scale data) | 94 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 219 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 292 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 292 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in heart, skeletal muscle, pancreas and brain. Weakly expressed in placenta, lung, liver, kidney and thymus.
Developmental stage
In spleen levels are lower in adult than in fetal tissue.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O95201 | GOLGA6L9 A6NEM1 | 3 | EBI-747343, EBI-5916454 | |
BINARY | O95201 | PICK1 Q9NRD5 | 3 | EBI-747343, EBI-79165 | |
BINARY | O95201 | TNS2 Q63HR2 | 3 | EBI-747343, EBI-949753 | |
BINARY | O95201 | TSGA10 Q9BZW7 | 3 | EBI-747343, EBI-744794 | |
BINARY | O95201 | UBQLN2 Q9UHD9 | 3 | EBI-747343, EBI-947187 | |
BINARY | O95201 | UBQLN4 Q9NRR5 | 2 | EBI-747343, EBI-711226 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-74 | Disordered | ||||
Sequence: MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDTQESLHIKMEPEEPHSEGASQEDGAQGAWGWA | ||||||
Compositional bias | 15-30 | Basic and acidic residues | ||||
Sequence: ETPPEVPDRGHPHQEM | ||||||
Compositional bias | 47-61 | Basic and acidic residues | ||||
Sequence: LHIKMEPEEPHSEGA | ||||||
Domain | 124-193 | KRAB | ||||
Sequence: VTFEDVALYLSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASGSSRQAGDEKEW | ||||||
Region | 173-195 | Disordered | ||||
Sequence: QAHGKGEASGSSRQAGDEKEWRG | ||||||
Region | 240-303 | Disordered | ||||
Sequence: ACGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPEKPNEEEKGAPESGEEGLAPDSEV | ||||||
Compositional bias | 259-275 | Pro residues | ||||
Sequence: RTPDAAPPDPSPTEPQE | ||||||
Compositional bias | 277-303 | Basic and acidic residues | ||||
Sequence: RVPEKPNEEEKGAPESGEEGLAPDSEV | ||||||
Zinc finger | 308-330 | C2H2-type 1 | ||||
Sequence: YRCEQCGKGFSWHSHLVTHRRTH | ||||||
Zinc finger | 336-358 | C2H2-type 2 | ||||
Sequence: YACTDCGKRFGRSSHLIQHQIIH | ||||||
Zinc finger | 364-386 | C2H2-type 3 | ||||
Sequence: YTCPACRKSFSHHSTLIQHQRIH | ||||||
Zinc finger | 392-414 | C2H2-type 4 | ||||
Sequence: YVCDRCAKRFTRRSDLVTHQGTH | ||||||
Zinc finger | 420-442 | C2H2-type 5 | ||||
Sequence: HKCPICAKCFTQSSALVTHQRTH | ||||||
Zinc finger | 448-470 | C2H2-type 6 | ||||
Sequence: YPCPECGKCFSQRSNLIAHNRTH | ||||||
Zinc finger | 476-498 | C2H2-type 7 | ||||
Sequence: YHCLDCGKSFSHSSHLTAHQRTH | ||||||
Zinc finger | 504-526 | C2H2-type 8 | ||||
Sequence: YACPLCGKSFSRRSNLHRHEKIH |
Domain
The KRAB domain is required for transcriptional repression.
Sequence similarities
Belongs to the krueppel C2H2-type zinc-finger protein family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length554
- Mass (Da)60,630
- Last updated2006-10-31 v2
- ChecksumB70DC15F0DFDC7FC
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 15-30 | Basic and acidic residues | ||||
Sequence: ETPPEVPDRGHPHQEM | ||||||
Compositional bias | 47-61 | Basic and acidic residues | ||||
Sequence: LHIKMEPEEPHSEGA | ||||||
Compositional bias | 259-275 | Pro residues | ||||
Sequence: RTPDAAPPDPSPTEPQE | ||||||
Compositional bias | 277-303 | Basic and acidic residues | ||||
Sequence: RVPEKPNEEEKGAPESGEEGLAPDSEV |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF060865 EMBL· GenBank· DDBJ | AAC70007.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AB672633 EMBL· GenBank· DDBJ | BAM10952.1 EMBL· GenBank· DDBJ | mRNA | ||
AC108134 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471112 EMBL· GenBank· DDBJ | EAW85396.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471112 EMBL· GenBank· DDBJ | EAW85398.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471112 EMBL· GenBank· DDBJ | EAW85399.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471112 EMBL· GenBank· DDBJ | EAW85400.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC002810 EMBL· GenBank· DDBJ | AAH02810.1 EMBL· GenBank· DDBJ | mRNA |