O94901 · SUN1_HUMAN
- ProteinSUN domain-containing protein 1
- GeneSUN1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids785 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning (By similarity).
Required for interkinetic nuclear migration (INM) and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration (By similarity).
Involved in telomere attachment to nuclear envelope in the prophase of meiosis implicating a SUN1/2:KASH5 LINC complex in which SUN1 and SUN2 seem to act at least partial redundantly (By similarity).
Required for gametogenesis and involved in selective gene expression of coding and non-coding RNAs needed for gametogenesis (By similarity).
Helps to define the distribution of nuclear pore complexes (NPCs) (By similarity).
Required for efficient localization of SYNE4 in the nuclear envelope (By similarity).
May be involved in nuclear remodeling during sperm head formation in spermatogenesis (By similarity).
May play a role in DNA repair by suppressing non-homologous end joining repair to facilitate the repair of DNA cross-links (PubMed:24375709).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome, telomeric region | |
Cellular Component | cytoplasm | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | meiotic nuclear membrane microtubule tethering complex | |
Cellular Component | nuclear envelope | |
Cellular Component | nuclear inner membrane | |
Cellular Component | nuclear membrane | |
Molecular Function | cytoskeleton-nuclear membrane anchor activity | |
Molecular Function | identical protein binding | |
Molecular Function | lamin binding | |
Molecular Function | protein-membrane adaptor activity | |
Biological Process | centrosome localization | |
Biological Process | homologous chromosome pairing at meiosis | |
Biological Process | meiotic attachment of telomere to nuclear envelope | |
Biological Process | nuclear matrix anchoring at nuclear membrane | |
Biological Process | nucleokinesis involved in cell motility in cerebral cortex radial glia guided migration | |
Biological Process | ossification | |
Biological Process | response to mechanical stimulus | |
Biological Process | spermatogenesis |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSUN domain-containing protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO94901
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-288 | Nuclear | ||||
Sequence: MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSRVYSRDRNQKCYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPGKAASGVFWWLGIGWYQFVTLISWLNVFLLTRCLRN | ||||||
Transmembrane | 289-308 | Helical | ||||
Sequence: ICKFLVLLIPLFLLLAGLSL | ||||||
Topological domain | 309-785 | Perinuclear space | ||||
Sequence: RGQGNFFSFLPVLNWASMHRTQRVDDPQDVFKPTTSRLKQPLQGDSEAFPWHWMSGVEQQVASLSGQCHHHGENLRELTTLLQKLQARVDQMEGGAAGPSASVRDAVGQPPRETDFMAFHQEHEVRMSHLEDILGKLREKSEAIQKELEQTKQKTISAVGEQLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_059828 | 118 | in dbSNP:rs6461378 | |||
Sequence: H → Y | ||||||
Natural variant | VAR_071065 | 203 | in dbSNP:rs144929525 | |||
Sequence: A → V | ||||||
Natural variant | VAR_071066 | 587 | in dbSNP:rs114701323 | |||
Sequence: A → V |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 899 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data), cross-link, disulfide bond.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000218911 | 1-785 | UniProt | SUN domain-containing protein 1 | |||
Sequence: MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSRVYSRDRNQKCYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPGKAASGVFWWLGIGWYQFVTLISWLNVFLLTRCLRNICKFLVLLIPLFLLLAGLSLRGQGNFFSFLPVLNWASMHRTQRVDDPQDVFKPTTSRLKQPLQGDSEAFPWHWMSGVEQQVASLSGQCHHHGENLRELTTLLQKLQARVDQMEGGAAGPSASVRDAVGQPPRETDFMAFHQEHEVRMSHLEDILGKLREKSEAIQKELEQTKQKTISAVGEQLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK | |||||||
Modified residue | 48 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 48 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 75 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 79 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 82 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 96 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 97 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 100 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 100 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 103 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 112 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 138 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 138 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 144 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 195 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 209 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 333 | UniProt | In isoform O94901-9; Phosphoserine | ||||
Sequence: D | |||||||
Modified residue | 344 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Disulfide bond | 630 | UniProt | Interchain (with KASH domain-containing nesprins) | ||||
Sequence: C |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O94901 | KASH5 Q8N6L0 | 5 | EBI-2796904, EBI-749265 | |
BINARY | O94901 | LMNA P02545 | 2 | EBI-2796904, EBI-351935 | |
BINARY | O94901 | SUN1 O94901 | 3 | EBI-2796904, EBI-2796904 | |
BINARY | O94901 | SYNE1 Q8NF91 | 6 | EBI-2796904, EBI-928867 | |
BINARY | O94901 | SYNE1 Q8NF91-1 | 2 | EBI-2796904, EBI-6170938 | |
BINARY | O94901 | SYNE2 Q8WXH0-1 | 2 | EBI-2796904, EBI-6170976 | |
BINARY | O94901 | SYNE4 Q8N205 | 7 | EBI-2796904, EBI-7131783 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, coiled coil, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-138 | LMNA-binding | ||||
Sequence: MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDES | ||||||
Region | 209-309 | In isoform O94901-9; SYNE2-binding | ||||
Sequence: SRVYSRDRNQKCYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPGKAASGVFWWLGIGWYQFVTLISWLNVFLLTRCLRNICKFLVLLIPLFLLLAGLSLR | ||||||
Region | 223-309 | In isoform O94901-9; EMD-binding | ||||
Sequence: LLQILRRIGAVGQAVSRTAWSALWLAVVAPGKAASGVFWWLGIGWYQFVTLISWLNVFLLTRCLRNICKFLVLLIPLFLLLAGLSLR | ||||||
Coiled coil | 428-495 | |||||
Sequence: HQEHEVRMSHLEDILGKLREKSEAIQKELEQTKQKTISAVGEQLLPTVEHLQLELDQLKSELSSWRHV | ||||||
Region | 574-785 | Sufficient for interaction with SYNE1 and SYNE2 | ||||
Sequence: TSEAVVSAVSEAGASGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK | ||||||
Domain | 622-784 | SUN | ||||
Sequence: GGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPV |
Domain
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 8 isoforms produced by Alternative splicing.
O94901-8
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length785
- Mass (Da)87,110
- Last updated2021-09-29 v4
- Checksum1099A50C9540ECF5
O94901-2
- Name2
O94901-3
- Name3
O94901-4
- Name4
O94901-5
- Name5
O94901-6
- Name6
- Differences from canonical
- 152-254: LDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSRVYSRDRNQKCYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPGK → K
O94901-7
- Name7
O94901-9
- Name8
- Differences from canonical
- 220-220: C → CGASFYVNRILWLARYTASSFSSFLVQLFQVVLMKLSYESENYKLKTHESKDCESESYKSKSHESKAHASYYGRMNVREVLREDGHLSVNGEALCDDCKGKRHLDAHTAAHSQSPRLPGRAGTLWHIWACAG
Computationally mapped potential isoform sequences
There are 12 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
C9JS54 | C9JS54_HUMAN | SUN1 | 113 | ||
C9JR15 | C9JR15_HUMAN | SUN1 | 88 | ||
C9JJU6 | C9JJU6_HUMAN | SUN1 | 118 | ||
C9JK55 | C9JK55_HUMAN | SUN1 | 174 | ||
C9K051 | C9K051_HUMAN | SUN1 | 135 | ||
H0Y742 | H0Y742_HUMAN | SUN1 | 710 | ||
H0Y6N5 | H0Y6N5_HUMAN | SUN1 | 634 | ||
H7C3X3 | H7C3X3_HUMAN | SUN1 | 158 | ||
H7C2K3 | H7C2K3_HUMAN | SUN1 | 427 | ||
H7C019 | H7C019_HUMAN | SUN1 | 171 | ||
E9PHI4 | E9PHI4_HUMAN | SUN1 | 822 | ||
A0A8I5G938 | A0A8I5G938_HUMAN | SUN1 | 682 |
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_061217 | 1 | in isoform 7 | |||
Sequence: M → MGRISPGSPGLPRTVWFEVVNM | ||||||
Alternative sequence | VSP_061216 | 1-50 | in isoform 5 | |||
Sequence: Missing | ||||||
Sequence conflict | 15 | in Ref. 3; CAD98070 | ||||
Sequence: V → A | ||||||
Sequence conflict | 78 | in Ref. 3; CAD98070 | ||||
Sequence: S → G | ||||||
Alternative sequence | VSP_061218 | 109 | in isoform 4 | |||
Sequence: R → V | ||||||
Alternative sequence | VSP_061219 | 110-785 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_061220 | 152-254 | in isoform 6 | |||
Sequence: LDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSRVYSRDRNQKCYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPGK → K | ||||||
Sequence conflict | 174 | in Ref. 1; BAA34530 | ||||
Sequence: A → V | ||||||
Sequence conflict | 204 | in Ref. 5; AAH13613 | ||||
Sequence: A → P | ||||||
Alternative sequence | VSP_061222 | 220 | in isoform 8 | |||
Sequence: C → CGASFYVNRILWLARYTASSFSSFLVQLFQVVLMKLSYESENYKLKTHESKDCESESYKSKSHESKAHASYYGRMNVREVLREDGHLSVNGEALCDDCKGKRHLDAHTAAHSQSPRLPGRAGTLWHIWACAG | ||||||
Alternative sequence | VSP_061221 | 220-253 | in isoform 5 | |||
Sequence: CYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPG → W | ||||||
Alternative sequence | VSP_061224 | 221-257 | in isoform 2 and isoform 7 | |||
Sequence: YFLLQILRRIGAVGQAVSRTAWSALWLAVVAPGKAAS → KSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP | ||||||
Alternative sequence | VSP_061223 | 221-341 | in isoform 3 | |||
Sequence: YFLLQILRRIGAVGQAVSRTAWSALWLAVVAPGKAASGVFWWLGIGWYQFVTLISWLNVFLLTRCLRNICKFLVLLIPLFLLLAGLSLRGQGNFFSFLPVLNWASMHRTQRVDDPQDVFKP → GASFYVNRILWLARYTASSFSSFLVQLFQVVLMKLSYESENYKLKTHESKDCESESYKSKSHESKAHASYYGRMNVREVLREDGHLSVNGEALCKYGFVFLWASVVELVPHAVMLGTSSRE | ||||||
Alternative sequence | VSP_061225 | 258-785 | in isoform 2 and isoform 7 | |||
Sequence: Missing | ||||||
Sequence conflict | 304 | in Ref. 2; BAG64069 | ||||
Sequence: Missing | ||||||
Alternative sequence | VSP_061226 | 342-785 | in isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 418 | in Ref. 2; BAG51119 | ||||
Sequence: P → L | ||||||
Sequence conflict | 476 | in Ref. 2; BAG64069 | ||||
Sequence: E → K | ||||||
Sequence conflict | 493 | in Ref. 2; BAG51119 | ||||
Sequence: R → Q |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB018353 EMBL· GenBank· DDBJ | BAA34530.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AK022469 EMBL· GenBank· DDBJ | BAB14046.1 EMBL· GenBank· DDBJ | mRNA | ||
AK022816 EMBL· GenBank· DDBJ | BAG51119.1 EMBL· GenBank· DDBJ | mRNA | ||
AK302896 EMBL· GenBank· DDBJ | BAG64069.1 EMBL· GenBank· DDBJ | mRNA | ||
AK309120 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
BX538211 EMBL· GenBank· DDBJ | CAD98070.1 EMBL· GenBank· DDBJ | mRNA | ||
AC073957 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC099731 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC013613 EMBL· GenBank· DDBJ | AAH13613.1 EMBL· GenBank· DDBJ | mRNA | ||
BC142707 EMBL· GenBank· DDBJ | AAI42708.1 EMBL· GenBank· DDBJ | mRNA | ||
AF202724 EMBL· GenBank· DDBJ | AAF15888.1 EMBL· GenBank· DDBJ | mRNA |