O94742 · SEM1_YEAST
- Protein26S proteasome complex subunit SEM1
- GeneSEM1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Versatile protein that might stabilize multiple protein complexes involved in diverse pathways. Subunit of the 26S proteasome which plays a role in ubiquitin-dependent proteolysis. Associates also with the TREX-2 complex that is required for transcription-coupled mRNA export, and the COP9 signalosome, which is involved in deneddylation.
Miscellaneous
Present with 5590 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | proteasome complex | |
Cellular Component | proteasome regulatory particle, lid subcomplex | |
Cellular Component | proteasome storage granule | |
Cellular Component | transcription export complex 2 | |
Molecular Function | molecular adaptor activity | |
Molecular Function | protein folding chaperone | |
Biological Process | double-strand break repair via homologous recombination | |
Biological Process | filamentous growth | |
Biological Process | maintenance of DNA trinucleotide repeats | |
Biological Process | mRNA export from nucleus | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | proteasome assembly | |
Biological Process | proteasome-mediated ubiquitin-dependent protein catabolic process | |
Biological Process | regulation of cell cycle | |
Biological Process | SAGA complex localization to transcription regulatory region | |
Biological Process | ubiquitin-dependent protein catabolic process |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended name26S proteasome complex subunit SEM1
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionO94742
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Impairs mRNA export and transcription elongation, and induces strong transcription-associated hyperrecombination phenotypes.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylserine | ||||
Sequence: S | ||||||
Chain | PRO_0000122970 | 2-89 | 26S proteasome complex subunit SEM1 | |||
Sequence: STDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ | ||||||
Modified residue | 12 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Part of the 26S proteasome. Associates with the nuclear pore complex (NPC)-associated TREX-2 complex and the COP9 signalosome. Interacts with CSN12 and THP3.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O94742 | HSM3 P38348 | 3 | EBI-31337, EBI-21152 | |
BINARY | O94742 | PRE1 P22141 | 2 | EBI-31337, EBI-13988 | |
BINARY | O94742 | RPN2 P32565 | 2 | EBI-31337, EBI-15919 | |
BINARY | O94742 | RPN3 P40016 | 2 | EBI-31337, EBI-15927 | |
BINARY | O94742 | RPN7 Q06103 | 4 | EBI-31337, EBI-15940 | |
BINARY | O94742 | RPT1 P33299 | 2 | EBI-31337, EBI-13910 | |
BINARY | O94742 | RPT6 Q01939 | 2 | EBI-31337, EBI-13914 | |
BINARY | O94742 | THP1 Q08231 | 2 | EBI-31337, EBI-32097 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length89
- Mass (Da)10,386
- Last updated1999-05-01 v1
- ChecksumB66B578ABB01E672
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF059310 EMBL· GenBank· DDBJ | AAD08804.1 EMBL· GenBank· DDBJ | mRNA | ||
AF065136 EMBL· GenBank· DDBJ | AAC96096.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U28372 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AY557719 EMBL· GenBank· DDBJ | AAS56045.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006938 EMBL· GenBank· DDBJ | DAA12202.1 EMBL· GenBank· DDBJ | Genomic DNA |