O89107 · DNSL3_RAT
- ProteinDeoxyribonuclease gamma
- GeneDnase1l3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids310 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Has DNA hydrolytic activity. Is capable of both single- and double-stranded DNA cleavage, producing DNA fragments with 3'-OH ends (PubMed:7957253).
Can cleave chromatin to nucleosomal units and cleaves nucleosomal and liposome-coated DNA. Acts in internucleosomal DNA fragmentation (INDF) during apoptosis and necrosis. The role in apoptosis includes myogenic and neuronal differentiation, and BCR-mediated clonal deletion of self-reactive B cells. Is active on chromatin in apoptotic cell-derived membrane-coated microparticles and thus suppresses anti-DNA autoimmunity (By similarity).
Together with DNASE1, plays a key role in degrading neutrophil extracellular traps (NETs) (By similarity).
NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation (By similarity).
Degradation of intravascular NETs by DNASE1 and DNASE1L3 is required to prevent formation of clots that obstruct blood vessels and cause organ damage following inflammation (By similarity).
Can cleave chromatin to nucleosomal units and cleaves nucleosomal and liposome-coated DNA. Acts in internucleosomal DNA fragmentation (INDF) during apoptosis and necrosis. The role in apoptosis includes myogenic and neuronal differentiation, and BCR-mediated clonal deletion of self-reactive B cells. Is active on chromatin in apoptotic cell-derived membrane-coated microparticles and thus suppresses anti-DNA autoimmunity (By similarity).
Together with DNASE1, plays a key role in degrading neutrophil extracellular traps (NETs) (By similarity).
NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation (By similarity).
Degradation of intravascular NETs by DNASE1 and DNASE1L3 is required to prevent formation of clots that obstruct blood vessels and cause organ damage following inflammation (By similarity).
Cofactor
Protein has several cofactor binding sites:
Activity regulation
Inhibited by zinc.
pH Dependence
Optimum pH is 7.2. Active from pH 6.0 to 9.0.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 105 | |||||
Sequence: E | ||||||
Active site | 160 | |||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | extracellular region | |
Cellular Component | nucleus | |
Molecular Function | deoxyribonuclease I activity | |
Molecular Function | DNA binding | |
Molecular Function | DNA endonuclease activity | |
Molecular Function | endonuclease activity | |
Biological Process | apoptotic DNA fragmentation | |
Biological Process | DNA catabolic process | |
Biological Process | neutrophil activation involved in immune response | |
Biological Process | programmed cell death involved in cell development | |
Biological Process | regulation of acute inflammatory response | |
Biological Process | regulation of neutrophil mediated cytotoxicity |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDeoxyribonuclease gamma
- EC number
- Short namesDNase gamma
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionO89107
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: May first pass through the ER membrane before being imported in the nucleus. Contradictory reports exist about the subcellular localization under normal physiological conditions. Under conditions of cell death, may diffuse and/or be actively transported to the nucleus (By similarity).
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MSLYPASPYLASLLLFILALHGALS | ||||||
Chain | PRO_0000007290 | 26-310 | Deoxyribonuclease gamma | |||
Sequence: LRLCSFNVRSFGESKKENHNAMDIIVKIIKRCDLILLMEIKDSNNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFLYKEKLVSVKAKYLYHDYQDGDTDVFSREPFVVWFQAPFTAAKDFVIVPLHTTPETSVKEIDELADVYTDVRRRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPNFVWLIGDQEDTTVKKSTSCAYDRIVLRGQEIVNSVVPRSSGVFDFQKAYELSEEEALDVSDHFPVEFKLQSSRAFTNSRKSVSLKKKKKGSRS | ||||||
Disulfide bond | 199↔236 | Essential for enzymatic activity | ||||
Sequence: CSYVPKKAWKNIRLRTDPNFVWLIGDQEDTTVKKSTSC |
Post-translational modification
Seems to be synthesized as an inactive precursor protein and converted into an active mature enzyme by removal of the N-terminal precursor peptide during apoptosis.
Poly-ADP-ribosylated by PARP1. ADP-ribosylation negatively regulates enzymatic activity during apoptosis.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected at high levels in spleen, lymph nodes, thymus and liver. Observed also in kidney and testis, but not in brain or heart.
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for motif, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 40-56 | Bipartite nuclear localization signal | ||||
Sequence: KKENHNAMDIIVKIIKR | ||||||
Region | 289-310 | Not required for free DNA-nuclease activity but required for activity towards liposome-coated DNA | ||||
Sequence: SRAFTNSRKSVSLKKKKKGSRS | ||||||
Motif | 301-307 | Nuclear localization signal | ||||
Sequence: LKKKKKG |
Sequence similarities
Belongs to the DNase I family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length310
- Mass (Da)35,708
- Last updated1998-11-01 v1
- Checksum69C0E0874A3E9107
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I5ZSG6 | A0A8I5ZSG6_RAT | Dnase1l3 | 293 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF039852 EMBL· GenBank· DDBJ | AAC28937.1 EMBL· GenBank· DDBJ | mRNA | ||
U75689 EMBL· GenBank· DDBJ | AAC40134.1 EMBL· GenBank· DDBJ | mRNA | ||
BC088122 EMBL· GenBank· DDBJ | AAH88122.1 EMBL· GenBank· DDBJ | mRNA |