O89020 · AFAM_MOUSE
- ProteinAfamin
- GeneAfm
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids608 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Functions as a carrier for hydrophobic molecules in body fluids. Essential for the solubility and activity of lipidated Wnt family members, including WNT1, WNT2B, WNT3, WNT3A, WNT5A, WNT7A, WNT7B, WNT8, WNT9A, WNT9B, WNT10A and WNT10B. Binds vitamin E. May transport vitamin E in body fluids under conditions where the lipoprotein system is not sufficient. May be involved in the transport of vitamin E across the blood-brain barrier.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | extracellular space | |
Molecular Function | vitamin E binding | |
Biological Process | protein stabilization | |
Biological Process | protein transport within extracellular region | |
Biological Process | vitamin transport |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAfamin
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionO89020
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MRHLKLTGFIFFLLPLTESLA | ||||||
Chain | PRO_0000001107 | 22-608 | Afamin | |||
Sequence: LPTKPQDVDHFNATQKFIDENTTYLAIIAFSQYVQEASFDEVETLVKVMLDYRDRCWADNTLPECSKTANDAIQDMLCDMEGLPQKHNFSHCCGKAGFPRRLCFFYNKKANVGFLPPFPTLDPEEKCQAYKNNSESFLHLYMYEVARRNPFVFAPVLLAVAAWFEEAATTCCEQQQKATCFQAKAAPITQYLKASSSYQRNVCGALIKFGPKVLNSINVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCCEGDVVHCIRSQSQVVNHICSKQDSISSKIKVCCEKKTLEREACIINANKDDRPEGLSLREAKFTESENVCQERDSDPDKFFAEFIYEYSRRHPDLSTPELLRITKVYMDFLEDCCSRENPAGCYRHVEDKFNETTQRSLAMVQQECKQFQELGKDTLQRHFLVKFTKAAPQLPMEELVSLSKEMVAALTTCCTLSDEFACVDNLADLVLGELCGVNTNRTINPAVDHCCKTDFAFRRHCFEHLKADTTYELPSVSALVSALHTDWCQPRKEDLQNKKHRFLVNLVKWMPGITDEEWLCLFTKFTAAREECSEVQEPESCFSPESSKTGDESQATEKQR | ||||||
Glycosylation | 33 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 77↔86 | |||||
Sequence: CWADNTLPEC | ||||||
Disulfide bond | 99↔114 | |||||
Sequence: CDMEGLPQKHNFSHCC | ||||||
Glycosylation | 109 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 113↔124 | |||||
Sequence: CCGKAGFPRRLC | ||||||
Disulfide bond | 148↔193 | |||||
Sequence: CQAYKNNSESFLHLYMYEVARRNPFVFAPVLLAVAAWFEEAATTCC | ||||||
Glycosylation | 153 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 192↔201 | |||||
Sequence: CCEQQQKATC | ||||||
Disulfide bond | 224↔270 | |||||
Sequence: CGALIKFGPKVLNSINVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCC | ||||||
Disulfide bond | 269↔277 | |||||
Sequence: CCEGDVVHC | ||||||
Disulfide bond | 289↔303 | |||||
Sequence: CSKQDSISSKIKVCC | ||||||
Disulfide bond | 302↔313 | |||||
Sequence: CCEKKTLEREAC | ||||||
Disulfide bond | 340↔385 | |||||
Sequence: CQERDSDPDKFFAEFIYEYSRRHPDLSTPELLRITKVYMDFLEDCC | ||||||
Disulfide bond | 384↔393 | |||||
Sequence: CCSRENPAGC | ||||||
Glycosylation | 402 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 416↔462 | |||||
Sequence: CKQFQELGKDTLQRHFLVKFTKAAPQLPMEELVSLSKEMVAALTTCC | ||||||
Disulfide bond | 461↔470 | |||||
Sequence: CCTLSDEFAC | ||||||
Disulfide bond | 483↔499 | |||||
Sequence: CGVNTNRTINPAVDHCC | ||||||
Glycosylation | 488 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 498↔509 | |||||
Sequence: CCKTDFAFRRHC | ||||||
Disulfide bond | 580↔589 | |||||
Sequence: CSEVQEPESC |
Post-translational modification
N-glycosylated; more than 90% of the glycans are sialylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected in brain, especially on brain capillaries (at protein level). Expressed in isolated brain capillaries.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 22-210 | Albumin 1 | ||||
Sequence: LPTKPQDVDHFNATQKFIDENTTYLAIIAFSQYVQEASFDEVETLVKVMLDYRDRCWADNTLPECSKTANDAIQDMLCDMEGLPQKHNFSHCCGKAGFPRRLCFFYNKKANVGFLPPFPTLDPEEKCQAYKNNSESFLHLYMYEVARRNPFVFAPVLLAVAAWFEEAATTCCEQQQKATCFQAKAAPIT | ||||||
Domain | 211-403 | Albumin 2 | ||||
Sequence: QYLKASSSYQRNVCGALIKFGPKVLNSINVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCCEGDVVHCIRSQSQVVNHICSKQDSISSKIKVCCEKKTLEREACIINANKDDRPEGLSLREAKFTESENVCQERDSDPDKFFAEFIYEYSRRHPDLSTPELLRITKVYMDFLEDCCSRENPAGCYRHVEDKFNE | ||||||
Region | 215-319 | Binding pocket for hydrophobic ligands | ||||
Sequence: ASSSYQRNVCGALIKFGPKVLNSINVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCCEGDVVHCIRSQSQVVNHICSKQDSISSKIKVCCEKKTLEREACIINANK | ||||||
Domain | 404-599 | Albumin 3 | ||||
Sequence: TTQRSLAMVQQECKQFQELGKDTLQRHFLVKFTKAAPQLPMEELVSLSKEMVAALTTCCTLSDEFACVDNLADLVLGELCGVNTNRTINPAVDHCCKTDFAFRRHCFEHLKADTTYELPSVSALVSALHTDWCQPRKEDLQNKKHRFLVNLVKWMPGITDEEWLCLFTKFTAAREECSEVQEPESCFSPESSKTGD | ||||||
Region | 583-608 | Disordered | ||||
Sequence: VQEPESCFSPESSKTGDESQATEKQR |
Domain
The second albumin domain forms a deep binding pocket that contains palmitoleic acid (in vitro). Palmitoleic acid is most likely not the physiological ligand. Instead, this pocket may accomodate the covalently bound lipid moiety of Wnt family members.
Sequence similarities
Belongs to the ALB/AFP/VDB family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 3 isoforms produced by Alternative splicing.
O89020-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length608
- Mass (Da)69,379
- Last updated2007-02-20 v2
- Checksum98B31E6D96E73F12
O89020-2
- Name2
O89020-3
- Name3
- Differences from canonical
- 606-608: KQR → NKITDQ
Sequence caution
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 44 | in Ref. 1; CAA09471 and 3; AAH26681 | ||||
Sequence: T → A | ||||||
Sequence conflict | 154 | in Ref. 1; CAA09471 | ||||
Sequence: N → K | ||||||
Sequence conflict | 280 | in Ref. 3; AAI00598 | ||||
Sequence: S → N | ||||||
Sequence conflict | 285 | in Ref. 1; CAA09471 | ||||
Sequence: V → E | ||||||
Sequence conflict | 295 | in Ref. 3; AAI00598 | ||||
Sequence: I → V | ||||||
Sequence conflict | 307 | in Ref. 3; AAI00598 | ||||
Sequence: T → I | ||||||
Sequence conflict | 369 | in Ref. 1; CAA09471 | ||||
Sequence: E → R | ||||||
Sequence conflict | 417 | in Ref. 1; CAA09471 | ||||
Sequence: K → N | ||||||
Alternative sequence | VSP_023387 | 430 | in isoform 2 | |||
Sequence: H → Q | ||||||
Alternative sequence | VSP_023388 | 431-608 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 520 | in Ref. 1; CAA09471 | ||||
Sequence: E → A | ||||||
Alternative sequence | VSP_023389 | 606-608 | in isoform 3 | |||
Sequence: KQR → NKITDQ |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ011080 EMBL· GenBank· DDBJ | CAA09471.1 EMBL· GenBank· DDBJ | mRNA | ||
AK143987 EMBL· GenBank· DDBJ | BAE25647.1 EMBL· GenBank· DDBJ | mRNA | ||
BC026681 EMBL· GenBank· DDBJ | AAH26681.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
BC100597 EMBL· GenBank· DDBJ | AAI00598.1 EMBL· GenBank· DDBJ | mRNA |