O89000 · DPYD_RAT
- ProteinDihydropyrimidine dehydrogenase [NADP(+)]
- GeneDpyd
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1025 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Involved in pyrimidine base degradation. Catalyzes the reduction of uracil and thymine. Also involved the degradation of the chemotherapeutic drug 5-fluorouracil.
Catalytic activity
- 5,6-dihydrouracil + NADP+ = H+ + NADPH + uracilThis reaction proceeds in the backward direction.
Cofactor
Protein has several cofactor binding sites:
Note: Binds 2 FAD.
Note: Binds 2 FMN.
Note: Binds 4 [4Fe-4S] clusters. Contains approximately 16 iron atoms per subunit.
Activity regulation
Inactivated by 5-iodouracil.
Pathway
Amino-acid biosynthesis; beta-alanine biosynthesis.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 79 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 82 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 87 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 91 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 129 | FAD (UniProtKB | ChEBI) | ||||
Sequence: V | ||||||
Binding site | 130 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 136 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 140 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 156 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 194-198 | FAD (UniProtKB | ChEBI) | ||||
Sequence: GAGPA | ||||||
Binding site | 218-226 | FAD (UniProtKB | ChEBI) | ||||
Sequence: EKQEYVGGL | ||||||
Binding site | 235 | FAD (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 340-343 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: AGDT | ||||||
Binding site | 364-365 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: RK | ||||||
Binding site | 371 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 437-439 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: PFG | ||||||
Binding site | 480-489 | FAD (UniProtKB | ChEBI) | ||||
Sequence: GDVVGMANTT | ||||||
Binding site | 481-487 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: DVVGMAN | ||||||
Binding site | 550 | FMN (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 574-575 | FMN (UniProtKB | ChEBI) | ||||
Sequence: KT | ||||||
Binding site | 609 | substrate | ||||
Sequence: N | ||||||
Binding site | 668-670 | substrate | ||||
Sequence: NLS | ||||||
Active site | 671 | Proton acceptor | ||||
Sequence: C | ||||||
Binding site | 709 | FMN (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 736-737 | substrate | ||||
Sequence: NT | ||||||
Binding site | 767 | FMN (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 793-795 | FMN (UniProtKB | ChEBI) | ||||
Sequence: TGG | ||||||
Binding site | 816-817 | FMN (UniProtKB | ChEBI) | ||||
Sequence: CS | ||||||
Binding site | 953 | [4Fe-4S] cluster 3 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 956 | [4Fe-4S] cluster 3 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 959 | [4Fe-4S] cluster 3 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 963 | [4Fe-4S] cluster 3 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 986 | [4Fe-4S] cluster 4 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 989 | [4Fe-4S] cluster 4 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 992 | [4Fe-4S] cluster 4 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 996 | [4Fe-4S] cluster 4 (UniProtKB | ChEBI) | ||||
Sequence: C |
GO annotations
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDihydropyrimidine dehydrogenase [NADP(+)]
- EC number
- Short namesDHPDHase; DPD
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionO89000
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000327502 | 1-1025 | Dihydropyrimidine dehydrogenase [NADP+] | |||
Sequence: MAGVLSRDAPDIESILALNPRIQAHATLRSTMAKKLDKKHWKRNTDKNCFICEKLENNFDDIKHTTLGERGALREAVRCLKCADAPCQKSCPTSLDIKSFITSIANKNYYGAAKLIFSDNPLGLTCGMVCPTSDLCVGGCNLHATEEGPINIGGLQQFATEVFKAMNIPQIRSPLLPPPEHMPEAYSAKIALFGAGPASISCASFLARLGYSDITIFEKQEYVGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSISTDEMTLSTLKENGYKAAFIGIGLPEPKKDHIFQGLTQVQGFYTSKDFLPLVAKGSKPGMCACHSPLPSVRGAVIVLGAGDTAFDCATSALRCGARRVFIVFRKGFANIRAVPEEMELAKEEKCEFLPFLSPRKVIVKDGKIVGMQFVRTEQDETGNWVEDEEQIVRLKADVVISPFGSVLDDPKVIEALSPIKFNRWGLPEVNPETMQTSEPWVFAGGDVVGMANTTVESVNDGKQASWYIHEYIQAQYGALVPSQPTLPLFYTPVDLVDISVEMAGLRFPNPFGLASATPATSTPMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPLYGPGQSSFLNIELISEKTAAYWCHSVTELKADFPDNILIASIMCSYNKNDWMELSKMAEASGADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQSVRVPFFAKLTPNVTDIVSIARAAKEGGADGVTATNTVSGLMGLKADGSPWPSVGSGKRTTYGGVSGTTIRPIALRAVTAIARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYLKSIEELSDWDGQSPPTMSHQKGKPVPHIAELMGQKLPSFGPYLERRKKILAASKIRENDQNRACSPLQRKHFNSQKPIPAIKDVIGKSLQYLGTFGELNIMEQVVALIDEEMCINCGKCYMTCNDSGYQAIQFDPETHLPTVSDTCTGCTLCLSVCPIMDCIRMVSRATPYEPKRGLPLAVKPVC | ||||||
Modified residue | 384 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 905 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 69-100 | 4Fe-4S ferredoxin-type 1 | ||||
Sequence: ERGALREAVRCLKCADAPCQKSCPTSLDIKSF | ||||||
Domain | 944-976 | 4Fe-4S ferredoxin-type 2 | ||||
Sequence: VVALIDEEMCINCGKCYMTCNDSGYQAIQFDPE | ||||||
Domain | 978-1007 | 4Fe-4S ferredoxin-type 3 | ||||
Sequence: HLPTVSDTCTGCTLCLSVCPIMDCIRMVSR |
Sequence similarities
Belongs to the dihydropyrimidine dehydrogenase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,025
- Mass (Da)111,468
- Last updated1998-11-01 v1
- Checksum07859E73D249828C
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0G2K355 | A0A0G2K355_RAT | Dpyd | 1025 | ||
F1M891 | F1M891_RAT | Dpyd | 971 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D85035 EMBL· GenBank· DDBJ | BAA33218.1 EMBL· GenBank· DDBJ | mRNA |