O88910 · MPP3_MOUSE
- ProteinMAGUK p55 subfamily member 3
- GeneMpp3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids568 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Participates in cell spreading through the phosphoinositide-3-kinase (PI3K) pathway by connecting CADM1 to DLG1 and the regulatory subunit of phosphoinositide-3-kinase (PI3K) (By similarity).
Stabilizes HTR2C at the plasma membrane and prevents its desensitization (PubMed:16914526).
May participates in the maintenance of adherens junctions (PubMed:23658188, PubMed:23893895).
Stabilizes HTR2C at the plasma membrane and prevents its desensitization (PubMed:16914526).
May participates in the maintenance of adherens junctions (PubMed:23658188, PubMed:23893895).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | adherens junction | |
Cellular Component | apical plasma membrane | |
Cellular Component | cell-cell junction | |
Cellular Component | plasma membrane | |
Molecular Function | PDZ domain binding |
Names & Taxonomy
Protein names
- Recommended nameMAGUK p55 subfamily member 3
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionO88910
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localized in apical villi of Mueller glia cells (PubMed:23893895).
Localized at the apical membrane in the developing cortex and colocalized with apical proteins and adherens junction proteins (PubMed:23658188).
Localized at the outer limiting membrane (OLM), and outer plexiform (OPL) of retina (By similarity).
Localized at the apical membrane in the developing cortex and colocalized with apical proteins and adherens junction proteins (PubMed:23658188).
Localized at the outer limiting membrane (OLM), and outer plexiform (OPL) of retina (By similarity).
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Conditional knockout mice Mpp3 in retina develop late onset retinal degeneration, with sporadic foci of rosette formation in the central part of the retina which is accelerated by exposure to moderate levels of white light (PubMed:23893895).
Conditional knockout mice Mpp3 during cortical development result in a gradual loss of the apical complex proteins and a disruption of adherens junctions (PubMed:23658188).
Conditional knockout mice Mpp3 during cortical development result in a gradual loss of the apical complex proteins and a disruption of adherens junctions (PubMed:23658188).
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000094576 | 1-568 | MAGUK p55 subfamily member 3 | |||
Sequence: MPVLSEDSGLHETLALLTSQLRPDSNHREEMGFLRDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAMALAEDVMEELQAASVHSDERELLQLLSTPHLRAVLMVHDTVAQKNFDPVLPPLPDNIDEDFEEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEEDRFKDSKVFMRALFHYDPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSKQFQERRLSYRRTTGTLPSPQNFKKPPYDQPCDKETCDCDGYFKGHYVAGLRRSFRLGCRERLGGSQEAKVPTGAESQVLLTYEEVARYQHQPGERPRLVVLIGSLGAHLHELKQRVVAEDPQQFAVAVPHTTRPRKSHERDGVEYHFVSKQAFEADVHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLVDVEPEALRHLRTPEFKPYVIFVKPAIQERRKTPPVSPDSEDIASSLDEQQQEMAASAAFIDQHYGHLIDTVLVRQDLQEPAASSELS | ||||||
Modified residue | 307 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in brain, skeletal muscle, testis, kidney, and lung.
Developmental stage
Expressed in E12.5 dorsal telencephalon in the developing cortex.
Interaction
Subunit
Interacts with HTR2C; this interaction stabilizes the receptor at the plasma membrane and prevents the desensitization of the HTR2C receptor-mediated calcium response (PubMed:14988405, PubMed:16914526).
Interacts with HTR2A (PubMed:14988405).
Interacts with HTR4 (PubMed:15466885).
Interacts (via PDZ domain) with CADM1 (via C-terminus)Interacts (via PDZ domain) with CADM1; this interaction connects CADM1 with DLG1 (By similarity).
Interacts (via Guanylate kinase-like domain) with PALS1 (PubMed:16519681).
Interacts with DLG1 (via N-terminus); this interaction connects CADM1 with DLG1 and links CADM1 with the regulatory subunit of phosphoinositide-3-kinase (PI3K) by forming a multiprotein complex and participates in cell spreading (PubMed:16519681).
Interacts with HTR2A (PubMed:14988405).
Interacts with HTR4 (PubMed:15466885).
Interacts (via PDZ domain) with CADM1 (via C-terminus)Interacts (via PDZ domain) with CADM1; this interaction connects CADM1 with DLG1 (By similarity).
Interacts (via Guanylate kinase-like domain) with PALS1 (PubMed:16519681).
Interacts with DLG1 (via N-terminus); this interaction connects CADM1 with DLG1 and links CADM1 with the regulatory subunit of phosphoinositide-3-kinase (PI3K) by forming a multiprotein complex and participates in cell spreading (PubMed:16519681).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 6-60 | L27 1 | ||||
Sequence: EDSGLHETLALLTSQLRPDSNHREEMGFLRDVFSEKSLSYLMKIHEKLRYYERQS | ||||||
Domain | 61-118 | L27 2 | ||||
Sequence: PTPVLHSAMALAEDVMEELQAASVHSDERELLQLLSTPHLRAVLMVHDTVAQKNFDPV | ||||||
Domain | 137-218 | PDZ | ||||
Sequence: IVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPAT | ||||||
Domain | 226-296 | SH3 | ||||
Sequence: DSKVFMRALFHYDPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSKQFQERRL | ||||||
Domain | 385-568 | Guanylate kinase-like | ||||
Sequence: PRLVVLIGSLGAHLHELKQRVVAEDPQQFAVAVPHTTRPRKSHERDGVEYHFVSKQAFEADVHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLVDVEPEALRHLRTPEFKPYVIFVKPAIQERRKTPPVSPDSEDIASSLDEQQQEMAASAAFIDQHYGHLIDTVLVRQDLQEPAASSELS |
Sequence similarities
Belongs to the MAGUK family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length568
- Mass (Da)64,401
- Last updated2011-07-27 v2
- Checksum078EC699D9DB0C93
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 3 | in Ref. 1; AAD12762 | ||||
Sequence: V → I | ||||||
Sequence conflict | 329 | in Ref. 1; AAD12762 | ||||
Sequence: G → E | ||||||
Sequence conflict | 429 | in Ref. 1; AAD12762 | ||||
Sequence: R → I | ||||||
Sequence conflict | 450 | in Ref. 1; AAD12762 | ||||
Sequence: K → R |
Keywords
- Technical term