O88574 · SAP30_MOUSE
- ProteinHistone deacetylase complex subunit SAP30
- GeneSap30
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids220 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the functional recruitment of the Sin3-histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes. Capable of transcription repression by N-CoR. Active in deacetylating core histone octamers (when in a complex) but inactive in deacetylating nucleosomal histones.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | histone deacetylase complex | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | Sin3-type complex | |
Molecular Function | DNA binding | |
Molecular Function | metal ion binding | |
Molecular Function | transcription coregulator activity | |
Molecular Function | transcription corepressor activity | |
Biological Process | modulation by host of symbiont transcription | |
Biological Process | negative regulation of cell migration | |
Biological Process | negative regulation of stem cell population maintenance | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | negative regulation of transforming growth factor beta receptor signaling pathway | |
Biological Process | positive regulation of stem cell population maintenance | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | skeletal muscle cell differentiation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHistone deacetylase complex subunit SAP30
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionO88574
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000097583 | 1-220 | Histone deacetylase complex subunit SAP30 | |||
Sequence: MNGFTPEEMSRGGDAAAAVAAVVAAAAAAASAGNGNAAGGGAEVPGAGAVSASGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH | ||||||
Modified residue | 5 | Phosphothreonine | ||||
Sequence: T | ||||||
Cross-link | 87 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 131 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 138 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 145 | Phosphothreonine | ||||
Sequence: T | ||||||
Cross-link | 194 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 214 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Component of the histone deacetylase complex that includes at least SIN3A, HDAC1 and HDAC2 (PubMed:9702189).
Found in a complex composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1 (PubMed:28554894).
Interacts with HDAC1 (PubMed:9702189).
Interacts with SIN3A, SIN3B, HDAC2, RBBP4 and NCOR1 (PubMed:9702189).
Interacts directly with SAMSN1 (PubMed:20478393).
Interacts with HCFC1 (By similarity).
Interacts with SAP30BP (By similarity).
Found in a complex composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1 (PubMed:28554894).
Interacts with HDAC1 (PubMed:9702189).
Interacts with SIN3A, SIN3B, HDAC2, RBBP4 and NCOR1 (PubMed:9702189).
Interacts directly with SAMSN1 (PubMed:20478393).
Interacts with HCFC1 (By similarity).
Interacts with SAP30BP (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O88574 | Ncor1 Q60974 | 3 | EBI-593511, EBI-349004 | |
BINARY | O88574 | Sin3a Q60520 | 6 | EBI-593511, EBI-349034 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-129 | Interaction with NCOR1 | ||||
Sequence: MNGFTPEEMSRGGDAAAAVAAVVAAAAAAASAGNGNAAGGGAEVPGAGAVSASGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRK | ||||||
Zinc finger | 67-115 | Atypical | ||||
Sequence: CCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYH | ||||||
Region | 123-143 | Disordered | ||||
Sequence: RNRRKRKGSDDDGGDSPVQDI | ||||||
Region | 130-220 | Interaction with SIN3A | ||||
Sequence: GSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH |
Sequence similarities
Belongs to the SAP30 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length220
- Mass (Da)23,231
- Last updated1998-11-01 v1
- ChecksumA9D4CBDAB97BBD8C
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF075136 EMBL· GenBank· DDBJ | AAC26007.1 EMBL· GenBank· DDBJ | mRNA | ||
AK010928 EMBL· GenBank· DDBJ | BAB27273.1 EMBL· GenBank· DDBJ | mRNA | ||
AK088745 EMBL· GenBank· DDBJ | BAC40543.1 EMBL· GenBank· DDBJ | mRNA | ||
CH466569 EMBL· GenBank· DDBJ | EDL28616.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC132081 EMBL· GenBank· DDBJ | AAI32082.1 EMBL· GenBank· DDBJ | mRNA | ||
BC132087 EMBL· GenBank· DDBJ | AAI32088.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ251216 EMBL· GenBank· DDBJ | CAC24848.1 EMBL· GenBank· DDBJ | Genomic DNA |