O88529 · BMAL1_MESAU
- ProteinBasic helix-loop-helix ARNT-like protein 1
- GeneBMAL1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids626 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Transcriptional activator which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in gene expression, which are translated into rhythms in metabolism and behavior. It is derived from the Latin roots 'circa' (about) and 'diem' (day) and acts as an important regulator of a wide array of physiological functions including metabolism, sleep, body temperature, blood pressure, endocrine, immune, cardiovascular, and renal function. Consists of two major components: the central clock, residing in the suprachiasmatic nucleus (SCN) of the brain, and the peripheral clocks that are present in nearly every tissue and organ system. Both the central and peripheral clocks can be reset by environmental cues, also known as Zeitgebers (German for 'timegivers'). The predominant Zeitgeber for the central clock is light, which is sensed by retina and signals directly to the SCN. The central clock entrains the peripheral clocks through neuronal and hormonal signals, body temperature and feeding-related cues, aligning all clocks with the external light/dark cycle. Circadian rhythms allow an organism to achieve temporal homeostasis with its environment at the molecular level by regulating gene expression to create a peak of protein expression once every 24 hours to control when a particular physiological process is most active with respect to the solar day. Transcription and translation of core clock components (CLOCK, NPAS2, BMAL1, BMAL2, PER1, PER2, PER3, CRY1 and CRY2) plays a critical role in rhythm generation, whereas delays imposed by post-translational modifications (PTMs) are important for determining the period (tau) of the rhythms (tau refers to the period of a rhythm and is the length, in time, of one complete cycle). A diurnal rhythm is synchronized with the day/night cycle, while the ultradian and infradian rhythms have a period shorter and longer than 24 hours, respectively. Disruptions in the circadian rhythms contribute to the pathology of cardiovascular diseases, cancer, metabolic syndromes and aging. A transcription/translation feedback loop (TTFL) forms the core of the molecular circadian clock mechanism. Transcription factors, CLOCK or NPAS2 and BMAL1 or BMAL2, form the positive limb of the feedback loop, act in the form of a heterodimer and activate the transcription of core clock genes and clock-controlled genes (involved in key metabolic processes), harboring E-box elements (5'-CACGTG-3') within their promoters. The core clock genes: PER1/2/3 and CRY1/2 which are transcriptional repressors form the negative limb of the feedback loop and interact with the CLOCK|NPAS2-BMAL1|BMAL2 heterodimer inhibiting its activity and thereby negatively regulating their own expression. This heterodimer also activates nuclear receptors NR1D1/2 and RORA/B/G, which form a second feedback loop and which activate and repress BMAL1 transcription, respectively. BMAL1 positively regulates myogenesis and negatively regulates adipogenesis via the transcriptional control of the genes of the canonical Wnt signaling pathway. Plays a role in normal pancreatic beta-cell function; regulates glucose-stimulated insulin secretion via the regulation of antioxidant genes NFE2L2/NRF2 and its targets SESN2, PRDX3, CCLC and CCLM. Negatively regulates the mTORC1 signaling pathway; regulates the expression of MTOR and DEPTOR. Controls diurnal oscillations of Ly6C inflammatory monocytes; rhythmic recruitment of the PRC2 complex imparts diurnal variation to chemokine expression that is necessary to sustain Ly6C monocyte rhythms. Regulates the expression of HSD3B2, STAR, PTGS2, CYP11A1, CYP19A1 and LHCGR in the ovary and also the genes involved in hair growth. Plays an important role in adult hippocampal neurogenesis by regulating the timely entry of neural stem/progenitor cells (NSPCs) into the cell cycle and the number of cell divisions that take place prior to cell-cycle exit. Regulates the circadian expression of CIART and KLF11. The CLOCK-BMAL1 heterodimer regulates the circadian expression of SERPINE1/PAI1, VWF, B3, CCRN4L/NOC, NAMPT, DBP, MYOD1, PPARGC1A, PPARGC1B, SIRT1, GYS2, F7, NGFR, GNRHR, BHLHE40/DEC1, ATF4, MTA1, KLF10 and also genes implicated in glucose and lipid metabolism. Promotes rhythmic chromatin opening, regulating the DNA accessibility of other transcription factors. The NPAS2-BMAL1 heterodimer positively regulates the expression of MAOA, F7 and LDHA and modulates the circadian rhythm of daytime contrast sensitivity by regulating the rhythmic expression of adenylate cyclase type 1 (ADCY1) in the retina. The preferred binding motif for the CLOCK-BMAL1 heterodimer is 5'-CACGTGA-3', which contains a flanking adenine nucleotide at the 3-prime end of the canonical 6-nucleotide E-box sequence. CLOCK specifically binds to the half-site 5'-CAC-3', while BMAL1 binds to the half-site 5'-GTGA-3'. The CLOCK-BMAL1 heterodimer also recognizes the non-canonical E-box motifs 5'-AACGTGA-3' and 5'-CATGTGA-3'. Essential for the rhythmic interaction of CLOCK with ASS1 and plays a critical role in positively regulating CLOCK-mediated acetylation of ASS1. Plays a role in protecting against lethal sepsis by limiting the expression of immune checkpoint protein CD274 in macrophages in a PKM2-dependent manner (By similarity).
Regulates the diurnal rhythms of skeletal muscle metabolism via transcriptional activation of genes promoting triglyceride synthesis (DGAT2) and metabolic efficiency (COQ10B) (By similarity).
Regulates the diurnal rhythms of skeletal muscle metabolism via transcriptional activation of genes promoting triglyceride synthesis (DGAT2) and metabolic efficiency (COQ10B) (By similarity).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 77 | Interaction with E-box DNA | ||||
Sequence: H | ||||||
Site | 80 | Interaction with E-box DNA | ||||
Sequence: I | ||||||
Site | 81 | Interaction with E-box DNA | ||||
Sequence: E | ||||||
Site | 85 | Interaction with E-box DNA | ||||
Sequence: R | ||||||
Site | 125 | Important for interaction with CLOCK | ||||
Sequence: L |
GO annotations
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameBasic helix-loop-helix ARNT-like protein 1
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Cricetidae > Cricetinae > Mesocricetus
Accessions
- Primary accessionO88529
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Shuttles between the nucleus and the cytoplasm and this nucleocytoplasmic shuttling is essential for the nuclear accumulation of CLOCK, target gene transcription and the degradation of the CLOCK-BMAL1 heterodimer. The sumoylated form localizes in the PML body. Sequestered to the cytoplasm in the presence of ID2.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000127157 | 1-626 | Basic helix-loop-helix ARNT-like protein 1 | |||
Sequence: MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSATDYQESMDTDKDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL | ||||||
Modified residue | 17 | Phosphoserine; by GSK3-beta | ||||
Sequence: S | ||||||
Modified residue | 21 | Phosphothreonine; by GSK3-beta | ||||
Sequence: T | ||||||
Modified residue | 78 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 90 | Phosphoserine; by CK2 | ||||
Sequence: S | ||||||
Cross-link | 252 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2 and SUMO3) | ||||
Sequence: K | ||||||
Cross-link | 259 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate | ||||
Sequence: K | ||||||
Cross-link | 259 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | ||||||
Modified residue | 538 | N6-acetyllysine | ||||
Sequence: K |
Post-translational modification
Ubiquitinated, leading to its proteasomal degradation. Deubiquitinated by USP9X.
O-glycosylated; contains O-GlcNAc. O-glycosylation by OGT prevents protein degradation by inhibiting ubiquitination. It also stabilizes the CLOCK-BMAL1 heterodimer thereby increasing CLOCK-BMAL1-mediated transcription of genes in the negative loop of the circadian clock such as PER1/2/3 and CRY1/2.
Acetylated on Lys-538 by CLOCK during the repression phase of the circadian cycle. Acetylation facilitates recruitment of CRY1 protein and initiates the repression phase of the circadian cycle. Acetylated at Lys-538 by KAT5 during the activation phase of the cycle, leading to recruitment of the positive transcription elongation factor b (P-TEFb) and BRD4, followed by productive elongation of circadian transcripts. Deacetylated by SIRT1, which may result in decreased protein stability.
Phosphorylated upon dimerization with CLOCK. Phosphorylation enhances the transcriptional activity, alters the subcellular localization and decreases the stability of the CLOCK-BMAL1 heterodimer by promoting its degradation. Phosphorylation shows circadian variations in the liver with a peak between CT10 to CT14. Phosphorylation at Ser-90 by CK2 is essential for its nuclear localization, its interaction with CLOCK and controls CLOCK nuclear entry. Dephosphorylation at Ser-78 is important for dimerization with CLOCK and transcriptional activity.
Sumoylated on Lys-259 upon dimerization with CLOCK. Predominantly conjugated to poly-SUMO2/3 rather than SUMO1 and the level of these conjugates undergo rhythmic variation, peaking at CT9-CT12. Sumoylation localizes it exclusively to the PML body and promotes its ubiquitination in the PML body, ubiquitin-dependent proteasomal degradation and the transcriptional activity of the CLOCK-BMAL1 heterodimer.
Undergoes lysosome-mediated degradation in a time-dependent manner in the liver.
Keywords
- PTM
Interaction
Subunit
Component of the circadian clock oscillator which includes the CRY1/2 proteins, CLOCK or NPAS2, BMAL1 or BMAL2, CSNK1D and/or CSNK1E, TIMELESS and the PER1/2/3 proteins (By similarity).
Forms a heterodimer with CLOCK (By similarity).
The CLOCK-BMAL1 heterodimer is required for E-box-dependent transactivation, for CLOCK nuclear translocation and degradation, and, for phosphorylation of both CLOCK and BMAL1 (By similarity).
Part of a nuclear complex which also includes RACK1 and PRKCA; RACK1 and PRKCA are recruited to the complex in a circadian manner (By similarity).
Interacts with NPAS2 (By similarity).
Interacts with EZH2 (By similarity).
Interacts with SUMO3 (By similarity).
Interacts with SIRT1 (By similarity).
Interacts with AHR (By similarity).
Interacts with ID1, ID2 and ID3 (By similarity).
Interacts with DDX4 (By similarity).
Interacts with OGT (By similarity).
Interacts with EED and SUZ12 (By similarity).
Interacts with MTA1 (By similarity).
Interacts with CIART (By similarity).
Interacts with HSP90 (By similarity).
Interacts with KAT2B and EP300 (By similarity).
Interacts with BHLHE40/DEC1 and BHLHE41/DEC2 (By similarity).
Interacts with RELB and the interaction is enhanced in the presence of CLOCK (By similarity).
Interacts with PER1, PER2, CRY1 and CRY2 and this interaction requires a translocation to the nucleus (By similarity).
Interaction of the CLOCK-BMAL1 heterodimer with PER or CRY inhibits transcription activation (By similarity).
Interaction of the CLOCK-BMAL1 with CRY1 is independent of DNA but with PER2 is off DNA (By similarity).
The CLOCK-BMAL1 heterodimer interacts with GSK3B (By similarity).
Interacts with KDM5A (By similarity).
Interacts with KMT2A; in a circadian manner (By similarity).
Interacts with UBE3A (By similarity).
Interacts with PRKCG (By similarity).
Interacts with MAGEL2 (By similarity).
Interacts with NCOA2 (By similarity).
Interacts with THRAP3 (By similarity).
The CLOCK-BMAL1 heterodimer interacts with PASD1 (By similarity).
Interacts with PASD1 (By similarity).
Interacts with USP9X (By similarity).
Interacts with PIWIL2 (via PIWI domain) (By similarity).
Interacts with HDAC3 (By similarity).
Interacts with HNF4A (By similarity).
Forms a heterodimer with CLOCK (By similarity).
The CLOCK-BMAL1 heterodimer is required for E-box-dependent transactivation, for CLOCK nuclear translocation and degradation, and, for phosphorylation of both CLOCK and BMAL1 (By similarity).
Part of a nuclear complex which also includes RACK1 and PRKCA; RACK1 and PRKCA are recruited to the complex in a circadian manner (By similarity).
Interacts with NPAS2 (By similarity).
Interacts with EZH2 (By similarity).
Interacts with SUMO3 (By similarity).
Interacts with SIRT1 (By similarity).
Interacts with AHR (By similarity).
Interacts with ID1, ID2 and ID3 (By similarity).
Interacts with DDX4 (By similarity).
Interacts with OGT (By similarity).
Interacts with EED and SUZ12 (By similarity).
Interacts with MTA1 (By similarity).
Interacts with CIART (By similarity).
Interacts with HSP90 (By similarity).
Interacts with KAT2B and EP300 (By similarity).
Interacts with BHLHE40/DEC1 and BHLHE41/DEC2 (By similarity).
Interacts with RELB and the interaction is enhanced in the presence of CLOCK (By similarity).
Interacts with PER1, PER2, CRY1 and CRY2 and this interaction requires a translocation to the nucleus (By similarity).
Interaction of the CLOCK-BMAL1 heterodimer with PER or CRY inhibits transcription activation (By similarity).
Interaction of the CLOCK-BMAL1 with CRY1 is independent of DNA but with PER2 is off DNA (By similarity).
The CLOCK-BMAL1 heterodimer interacts with GSK3B (By similarity).
Interacts with KDM5A (By similarity).
Interacts with KMT2A; in a circadian manner (By similarity).
Interacts with UBE3A (By similarity).
Interacts with PRKCG (By similarity).
Interacts with MAGEL2 (By similarity).
Interacts with NCOA2 (By similarity).
Interacts with THRAP3 (By similarity).
The CLOCK-BMAL1 heterodimer interacts with PASD1 (By similarity).
Interacts with PASD1 (By similarity).
Interacts with USP9X (By similarity).
Interacts with PIWIL2 (via PIWI domain) (By similarity).
Interacts with HDAC3 (By similarity).
Interacts with HNF4A (By similarity).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, motif, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-33 | Polar residues | ||||
Sequence: MADQRMDISSTISDFMSPGPTDLLSSSLGTSGV | ||||||
Region | 1-58 | Disordered | ||||
Sequence: MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSATDYQESMDTDKDDPH | ||||||
Motif | 36-41 | Nuclear localization signal | ||||
Sequence: NRKRKG | ||||||
Compositional bias | 38-58 | Basic and acidic residues | ||||
Sequence: KRKGSATDYQESMDTDKDDPH | ||||||
Domain | 72-125 | bHLH | ||||
Sequence: NAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTL | ||||||
Motif | 142-152 | Nuclear export signal 1 | ||||
Sequence: LSDDELKHLIL | ||||||
Domain | 143-215 | PAS 1 | ||||
Sequence: SDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAP | ||||||
Domain | 326-396 | PAS 2 | ||||
Sequence: PQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTR | ||||||
Motif | 361-369 | Nuclear export signal 2 | ||||
Sequence: LAYLPQELL | ||||||
Domain | 401-444 | PAC | ||||
Sequence: TNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLAN | ||||||
Region | 459-492 | Disordered | ||||
Sequence: SPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGA | ||||||
Region | 508-588 | Interaction with CIART | ||||
Sequence: RIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQ | ||||||
Region | 511-595 | Disordered | ||||
Sequence: GSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSN | ||||||
Compositional bias | 512-532 | Polar residues | ||||
Sequence: SSPSSCGSSPLNITSTPPPDA | ||||||
Compositional bias | 552-574 | Polar residues | ||||
Sequence: GLLPGQAQETPGYPYSDSSSILG |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length626
- Mass (Da)68,701
- Last updated1998-11-01 v1
- Checksum65FDD28B38F1E016
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-33 | Polar residues | ||||
Sequence: MADQRMDISSTISDFMSPGPTDLLSSSLGTSGV | ||||||
Compositional bias | 38-58 | Basic and acidic residues | ||||
Sequence: KRKGSATDYQESMDTDKDDPH | ||||||
Compositional bias | 512-532 | Polar residues | ||||
Sequence: SSPSSCGSSPLNITSTPPPDA | ||||||
Compositional bias | 552-574 | Polar residues | ||||
Sequence: GLLPGQAQETPGYPYSDSSSILG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF070917 EMBL· GenBank· DDBJ | AAC23606.1 EMBL· GenBank· DDBJ | mRNA |