O88346 · TNNT1_MOUSE
- ProteinTroponin T, slow skeletal muscle
- GeneTnnt1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids262 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | troponin complex | |
Molecular Function | tropomyosin binding | |
Molecular Function | troponin T binding | |
Biological Process | negative regulation of muscle contraction | |
Biological Process | sarcomere organization | |
Biological Process | slow-twitch skeletal muscle fiber contraction | |
Biological Process | transition between fast and slow fiber |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTroponin T, slow skeletal muscle
- Short namesTnTs
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionO88346
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000186169 | 1-262 | Troponin T, slow skeletal muscle | |||
Sequence: MSDTEEQEYEEEQAEDEEAVEEEEAPEEPEPVAEREEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK | ||||||
Modified residue | 2 | Phosphoserine; by CK2 | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in adult soleus muscle.
Developmental stage
In masseter expression decreases during development and becomes undetectable 3 weeks after birth.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-31 | Acidic residues | ||||
Sequence: MSDTEEQEYEEEQAEDEEAVEEEEAPEEPEP | ||||||
Region | 1-62 | Disordered | ||||
Sequence: MSDTEEQEYEEEQAEDEEAVEEEEAPEEPEPVAEREEERPKPSRPVVPPLIPPKIPEGERVD | ||||||
Region | 109-153 | Disordered | ||||
Sequence: ERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKV |
Sequence similarities
Belongs to the troponin T family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
O88346-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsHigh Mr-1
- NoteMajor.
- Length262
- Mass (Da)31,344
- Last updated2007-01-23 v3
- ChecksumE0B0FE519714FBE1
O88346-2
- Name2
- SynonymsHigh Mr-2
- NoteMajor.
- Differences from canonical
- 38-38: Missing
O88346-3
- Name3
- SynonymsLow Mr
- NoteMinor.
- Differences from canonical
- 24-35: Missing
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Features
Showing features for compositional bias, alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF020946 EMBL· GenBank· DDBJ | AAC32546.1 EMBL· GenBank· DDBJ | mRNA | ||
U92883 EMBL· GenBank· DDBJ | AAC32540.1 EMBL· GenBank· DDBJ | mRNA | ||
U92884 EMBL· GenBank· DDBJ | AAC32541.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ131711 EMBL· GenBank· DDBJ | CAB38082.1 EMBL· GenBank· DDBJ | mRNA | ||
U92882 EMBL· GenBank· DDBJ | AAD00730.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC141142 EMBL· GenBank· DDBJ | AAI41143.1 EMBL· GenBank· DDBJ | mRNA | ||
BC145450 EMBL· GenBank· DDBJ | AAI45451.1 EMBL· GenBank· DDBJ | mRNA | ||
BC145451 EMBL· GenBank· DDBJ | AAI45452.1 EMBL· GenBank· DDBJ | mRNA |