O88342 · WDR1_MOUSE
- ProteinWD repeat-containing protein 1
- GeneWdr1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids606 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Induces disassembly of actin filaments in conjunction with ADF/cofilin family proteins (By similarity).
Enhances cofilin-mediated actin severing (PubMed:25915128).
Involved in cytokinesis. Involved in chemotactic cell migration by restricting lamellipodial membrane protrusions (By similarity).
Involved in myocardium sarcomere organization. Required for cardiomyocyte growth at the postnatal and maintenance at the adult stage (PubMed:24840128).
Involved in neutrophil actin dynamics and migration. Involved in megakaryocyte maturation and platelet shedding (PubMed:17515402).
Required for the establishment of planar cell polarity (PCP) during follicular epithelium development and for cell shape changes during PCP; the function seems to implicate cooperation with CFL1 and/or DSTN/ADF. Involved in the generation/maintenance of cortical tension (PubMed:25915128).
Involved in assembly and maintenance of epithelial apical cell junctions and plays a role in the organization of the perijunctional actomyosin belt (By similarity).
Enhances cofilin-mediated actin severing (PubMed:25915128).
Involved in cytokinesis. Involved in chemotactic cell migration by restricting lamellipodial membrane protrusions (By similarity).
Involved in myocardium sarcomere organization. Required for cardiomyocyte growth at the postnatal and maintenance at the adult stage (PubMed:24840128).
Involved in neutrophil actin dynamics and migration. Involved in megakaryocyte maturation and platelet shedding (PubMed:17515402).
Required for the establishment of planar cell polarity (PCP) during follicular epithelium development and for cell shape changes during PCP; the function seems to implicate cooperation with CFL1 and/or DSTN/ADF. Involved in the generation/maintenance of cortical tension (PubMed:25915128).
Involved in assembly and maintenance of epithelial apical cell junctions and plays a role in the organization of the perijunctional actomyosin belt (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameWD repeat-containing protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionO88342
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Embryonic lethal. Partial deficiencies disrupt megakaryocyte maturation, platelet shedding and provoke neutrophilic autoinflammatory disease.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 27 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000051342 | 1-606 | WD repeat-containing protein 1 | |||
Sequence: MPYEIKKVFASLPQVERGVSKILGGDPKGDHFLYTNGKCVILRNIDNPAIADIYTEHAHQVVVAKYAPSGFYIASGDISGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDTGSSVGEITGHNKVINSVDIKQTRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIFIYDGKTGEKVCALGESKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVNVNSVVSTFPMGSNVLDQQLGCLWQKDHLLSISLSGYINYLDKNNPSKPLRVIKGHSKSIQCLTVHRNGGKSYIYSGSHDGHINYWDSETGENDSFSGKGHTNQVSRMTVNESEQLVSCSMDDTVRYTNLTLRDYSGQGVVKLDVQPKCVAVGPGGYTVVVCIGQIVLLKDQKKCFSIDNPGYEPEVVAVHPGGDTVAVGGTDGNVRVYSILASTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETKVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTITY | ||||||
Modified residue | 28 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 81 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 95 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 115 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 238 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 480 | N6-acetyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
2D gel databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 4-45 | WD 1 | ||||
Sequence: EIKKVFASLPQVERGVSKILGGDPKGDHFLYTNGKCVILRNI | ||||||
Repeat | 48-87 | WD 2 | ||||
Sequence: PAIADIYTEHAHQVVVAKYAPSGFYIASGDISGKLRIWDT | ||||||
Repeat | 93-135 | WD 3 | ||||
Sequence: LLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDT | ||||||
Repeat | 138-176 | WD 4 | ||||
Sequence: SVGEITGHNKVINSVDIKQTRPYRLATGSDDNCAAFFEG | ||||||
Repeat | 180-218 | WD 5 | ||||
Sequence: KFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIFIYDG | ||||||
Repeat | 224-263 | WD 6 | ||||
Sequence: VCALGESKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDV | ||||||
Repeat | 270-306 | WD 7 | ||||
Sequence: STFPMGSNVLDQQLGCLWQKDHLLSISLSGYINYLDK | ||||||
Repeat | 311-351 | WD 8 | ||||
Sequence: KPLRVIKGHSKSIQCLTVHRNGGKSYIYSGSHDGHINYWDS | ||||||
Repeat | 358-408 | WD 9 | ||||
Sequence: SFSGKGHTNQVSRMTVNESEQLVSCSMDDTVRYTNLTLRDYSGQGVVKLDV | ||||||
Repeat | 432-474 | WD 10 | ||||
Sequence: LKDQKKCFSIDNPGYEPEVVAVHPGGDTVAVGGTDGNVRVYSI | ||||||
Repeat | 480-518 | WD 11 | ||||
Sequence: KDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSV | ||||||
Repeat | 523-561 | WD 12 | ||||
Sequence: SENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWTL | ||||||
Repeat | 566-604 | WD 13 | ||||
Sequence: TKVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTI |
Sequence similarities
Belongs to the WD repeat AIP1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length606
- Mass (Da)66,407
- Last updated2007-01-23 v3
- Checksum573CEA1DCD7CA80E
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0J9YU05 | A0A0J9YU05_MOUSE | Wdr1 | 333 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF020055 EMBL· GenBank· DDBJ | AAD05043.1 EMBL· GenBank· DDBJ | mRNA |