O82660 · P2SAF_ARATH
- ProteinPhotosystem II stability/assembly factor HCF136, chloroplastic
- GeneHCF136
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids403 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Essential for photosystem II (PSII) biogenesis; required for assembly of an early intermediate in PSII assembly that includes D2 (psbD) and cytochrome b559. Has been suggested (PubMed:11826309) to be required for chlorophyll a binding.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast envelope | |
Cellular Component | chloroplast stroma | |
Cellular Component | chloroplast stromal thylakoid | |
Cellular Component | chloroplast thylakoid | |
Cellular Component | chloroplast thylakoid lumen | |
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | photosystem II | |
Cellular Component | plastid | |
Cellular Component | thylakoid | |
Cellular Component | thylakoid lumen | |
Biological Process | photosynthesis | |
Biological Process | plastid organization | |
Biological Process | protein-containing complex assembly |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended namePhotosystem II stability/assembly factor HCF136, chloroplastic
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO82660
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Seedling lethal when homozygous, has pale cotyledons but never develops true leaves. On sucrose-supplemented medium PSII is completely inactive; D1, D2 CP43 and CP47 are present in very low amounts.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 55-56 | Protein is imported into chloroplasts but is unable to translocate into the thylakoid lumen. | ||||
Sequence: RR → KK |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 16 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-53 | Chloroplast | ||||
Sequence: MASLQLCDGYLLFKPSVSPRFLSQRISHRLIPKASSSPPPSPSPSSSSSSLSF | ||||||
Transit peptide | 54-78 | Thylakoid | ||||
Sequence: SRRELLYQSAAVSLSLSSIVGPARA | ||||||
Chain | PRO_0000005341 | 79-403 | Photosystem II stability/assembly factor HCF136, chloroplastic | |||
Sequence: DEQLSEWERVFLPIDPGVVLLDIAFVPDEPSRGFLLGTRQTLLETKDGGSTWNPRSIPSAEEEDFNYRFNSISFKGKEGWIIGKPAILLYTADAGENWDRIPLSSQLPGDMVFIKATEDKSAEMVTDEGAIYVTSNRGYNWKAAIQETVSATLNRTVSSGISGASYYTGTFSAVNRSPDGRYVAVSSRGNFFLTWEPGQPYWQPHNRAVARRIQNMGWRADGGLWLLVRGGGLYLSKGTGITEEFEEVPVQSRGFGILDVGYRSEEEAWAAGGSGILLRTRNGGKSWNRDKAADNIAANLYAVKFVDDKKGFVLGNDGVLLRYVG |
Proteomic databases
Expression
Tissue specificity
Expression in green tissue, not roots.
Developmental stage
Accumulates also in dark-grown seedlings.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 31-50 | Disordered | ||||
Sequence: IPKASSSPPPSPSPSSSSSS |
Domain
A 7-bladed beta-propeller torus, about 54 by 55 Angstroms, with a depth of about 25 Angstroms and a central pore.
Sequence similarities
Belongs to the Ycf48 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length403
- Mass (Da)44,104
- Last updated1998-11-01 v1
- Checksum11079552F817FF9D
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8BG37 | A0A1P8BG37_ARATH | HCF136 | 426 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y15628 EMBL· GenBank· DDBJ | CAA75723.1 EMBL· GenBank· DDBJ | mRNA | ||
AB006708 EMBL· GenBank· DDBJ | BAB09829.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED93124.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY045691 EMBL· GenBank· DDBJ | AAK74049.1 EMBL· GenBank· DDBJ | mRNA | ||
BT004549 EMBL· GenBank· DDBJ | AAO42795.1 EMBL· GenBank· DDBJ | mRNA | ||
AK221097 EMBL· GenBank· DDBJ | BAD94976.1 EMBL· GenBank· DDBJ | mRNA |