O82229 · SCP23_ARATH
- ProteinPutative serine carboxypeptidase-like 23
- GeneSCPL23
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids454 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Probable carboxypeptidase.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 178 | |||||
Sequence: S | ||||||
Active site | 375 | |||||
Sequence: D | ||||||
Active site | 427 | |||||
Sequence: H |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Molecular Function | serine-type carboxypeptidase activity | |
Biological Process | brassinosteroid mediated signaling pathway | |
Biological Process | proteolysis |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended namePutative serine carboxypeptidase-like 23
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO82229
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MARIHLIIILLVISSTSSSSSS | ||||||
Chain | PRO_0000274639 | 23-454 | Putative serine carboxypeptidase-like 23 | |||
Sequence: LREQEEDMIKALPGQPQVGFSQFSGYVTVNESHGRSLFYWLTESPSSSHTKPLLLWLNGGPGCSSIGYGASEEIGPFRINKTGSNLYLNKFTWNTEANILFLESPAGVGFSYTNTSSDLKDSGDERTAQENLIFLIKWMSRFPQYQYRDFYIVGESYAGHYVPQLAKKIHLYNKAFNNTPIINLKGFMVGNGDMDKHYDRLGAAMYAWSHAMISDKTYKSILKHCSFTADKTSDKCNWALYFAYREFGKVNGYSIYSPSCVHQTNQTKFLHGRLLVEEYEYDPCTESYAEIYYNRPDVQRAMHANLTSIPYKWTLCNMVVNNNWKDSEFSMLPIYKELTAAGLRIWVFSGDTDAVVPVTGTRLALSKLNLPVKTPWYPWYSEKQVGGWTEVYEGLTFATIRGAGHEVPVLQPERALTLLRSFLAGKELPRSY | ||||||
Glycosylation | 52 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 85↔338 | |||||
Sequence: CSSIGYGASEEIGPFRINKTGSNLYLNKFTWNTEANILFLESPAGVGFSYTNTSSDLKDSGDERTAQENLIFLIKWMSRFPQYQYRDFYIVGESYAGHYVPQLAKKIHLYNKAFNNTPIINLKGFMVGNGDMDKHYDRLGAAMYAWSHAMISDKTYKSILKHCSFTADKTSDKCNWALYFAYREFGKVNGYSIYSPSCVHQTNQTKFLHGRLLVEEYEYDPCTESYAEIYYNRPDVQRAMHANLTSIPYKWTLC | ||||||
Glycosylation | 102 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 136 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 247↔258 | |||||
Sequence: CSFTADKTSDKC | ||||||
Disulfide bond | 282↔306 | |||||
Sequence: CVHQTNQTKFLHGRLLVEEYEYDPC | ||||||
Glycosylation | 287 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 327 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length454
- Mass (Da)51,528
- Last updated2007-02-06 v2
- ChecksumF15930B2E16B5F4C
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8B146 | A0A1P8B146_ARATH | SCPL23 | 357 | ||
A0A1P8B149 | A0A1P8B149_ARATH | SCPL23 | 469 | ||
A0A1P8B140 | A0A1P8B140_ARATH | SCPL23 | 465 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC005170 EMBL· GenBank· DDBJ | AAC63669.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
CP002685 EMBL· GenBank· DDBJ | AEC07517.2 EMBL· GenBank· DDBJ | Genomic DNA |