O80341 · EF102_ARATH
- ProteinEthylene-responsive transcription factor 5
- GeneERF5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids300 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 155-213 | AP2/ERF | ||||
Sequence: HYRGVRQRPWGKFAAEIRDPNKRGSRVWLGTFDTAIEAARAYDEAAFRLRGSKAILNFP |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | defense response | |
Biological Process | ethylene-activated signaling pathway | |
Biological Process | response to auxin | |
Biological Process | response to cold |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameEthylene-responsive transcription factor 5
- Short namesAtERF5
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO80341
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000112563 | 1-300 | Ethylene-responsive transcription factor 5 | |||
Sequence: MATPNEVSALWFIEKHLLDEASPVATDPWMKHESSSATESSSDSSSIIFGSSSSSFAPIDFSESVCKPEIIDLDTPRSMEFLSIPFEFDSEVSVSDFDFKPSNQNQNQFEPELKSQIRKPPLKISLPAKTEWIQFAAENTKPEVTKPVSEEEKKHYRGVRQRPWGKFAAEIRDPNKRGSRVWLGTFDTAIEAARAYDEAAFRLRGSKAILNFPLEVGKWKPRADEGEKKRKRDDDEKVTVVEKVLKTEQSVDVNGGETFPFVTSNLTELCDWDLTGFLNFPLLSPLSPHPPFGYSQLTVV |
Proteomic databases
Expression
Induction
Ethylene induction is completely dependent on a functional ETHYLENE-INSENSITIVE2 (EIN2). Wounding as well as cold stress induction does not require EIN2. Transcripts accumulate strongly in cycloheximide-treated plants, a protein synthesis inhibitor. Seems to not be influenced by jasmonate, Alternaria brassicicola, exogenous abscisic acid (ABA), cold, heat, NaCl or drought stress.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 28-48 | Disordered | ||||
Sequence: PWMKHESSSATESSSDSSSII | ||||||
Compositional bias | 29-48 | Polar residues | ||||
Sequence: WMKHESSSATESSSDSSSII |
Domain
The AP2/ERF domain binds specifically to the 5'-GCCGCC-3' motif. The affinity of this binding is higher if the seventh amino-acid of this domain is basic (By similarity).
Sequence similarities
Belongs to the AP2/ERF transcription factor family. ERF subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length300
- Mass (Da)33,810
- Last updated1998-11-01 v1
- Checksum1189D464A28F7251
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 29-48 | Polar residues | ||||
Sequence: WMKHESSSATESSSDSSSII |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB008107 EMBL· GenBank· DDBJ | BAA32422.1 EMBL· GenBank· DDBJ | mRNA | ||
AB018117 EMBL· GenBank· DDBJ | BAA97157.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002688 EMBL· GenBank· DDBJ | AED95489.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK117568 EMBL· GenBank· DDBJ | BAC42229.1 EMBL· GenBank· DDBJ | mRNA | ||
AF385709 EMBL· GenBank· DDBJ | AAK60301.1 EMBL· GenBank· DDBJ | mRNA | ||
AY078014 EMBL· GenBank· DDBJ | AAL77715.1 EMBL· GenBank· DDBJ | mRNA |