O76071 · CIAO1_HUMAN
- ProteinProbable cytosolic iron-sulfur protein assembly protein CIAO1
- GeneCIAO1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids339 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins (PubMed:17937914, PubMed:23891004).
As a CIA complex component, interacts specifically with CIAO2A or CIAO2B and MMS19 to assist different branches of iron-sulfur protein assembly, depending of its interactors. The complex CIAO1:CIAO2B:MMS19 binds to and facilitates the assembly of most cytosolic-nuclear Fe/S proteins. CIAO1:CIAO2A specifically matures ACO1 and stabilizes IREB2 (PubMed:23891004).
Seems to specifically modulate the transactivation activity of WT1 (PubMed:9556563).
As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation (PubMed:20797633).
As a CIA complex component, interacts specifically with CIAO2A or CIAO2B and MMS19 to assist different branches of iron-sulfur protein assembly, depending of its interactors. The complex CIAO1:CIAO2B:MMS19 binds to and facilitates the assembly of most cytosolic-nuclear Fe/S proteins. CIAO1:CIAO2A specifically matures ACO1 and stabilizes IREB2 (PubMed:23891004).
Seems to specifically modulate the transactivation activity of WT1 (PubMed:9556563).
As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation (PubMed:20797633).
Miscellaneous
'Ciao' means 'bridge' in Chinese.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosolic [4Fe-4S] assembly targeting complex | |
Cellular Component | MMXD complex | |
Biological Process | chromosome segregation | |
Biological Process | iron-sulfur cluster assembly | |
Biological Process | positive regulation of cell population proliferation | |
Biological Process | protein maturation by iron-sulfur cluster transfer | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProbable cytosolic iron-sulfur protein assembly protein CIAO1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO76071
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 87-89 | Does not affect binding to HSC20. | ||||
Sequence: IWK → AAA | ||||||
Mutagenesis | 176-178 | Abolishes binding to HSC20. | ||||
Sequence: LYR → AAA |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 368 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000051389 | 1-339 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 | |||
Sequence: MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL |
Proteomic databases
PTM databases
Interaction
Subunit
Component of the CIA complex (PubMed:22678361, PubMed:22678362, PubMed:23585563).
Interacts with CIAO2A and forms a complex with CIAO2B and MMS19; the interactions with CIAO2A and CIAO2B are mutually exclusive (PubMed:22683786, PubMed:23585563, PubMed:23891004).
Interacts with CHD1L, ERCC2, IREB2 and POLD1 (PubMed:23891004).
Component of the MMXD complex, which includes CIAO1, ERCC2, CIAO2B, MMS19 and SLC25A5 (PubMed:20797633).
Interacts with WT1 (PubMed:9556563).
Interacts with CIAO3 (PubMed:23585563).
Interacts (via LYR motif) with HSC20 (PubMed:29309586).
Interacts with CIAO2A and forms a complex with CIAO2B and MMS19; the interactions with CIAO2A and CIAO2B are mutually exclusive (PubMed:22683786, PubMed:23585563, PubMed:23891004).
Interacts with CHD1L, ERCC2, IREB2 and POLD1 (PubMed:23891004).
Component of the MMXD complex, which includes CIAO1, ERCC2, CIAO2B, MMS19 and SLC25A5 (PubMed:20797633).
Interacts with WT1 (PubMed:9556563).
Interacts with CIAO3 (PubMed:23585563).
Interacts (via LYR motif) with HSC20 (PubMed:29309586).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O76071 | ANKRD55 Q3KP44 | 3 | EBI-725145, EBI-14493093 | |
BINARY | O76071 | C19orf2 Q6NX55 | 3 | EBI-725145, EBI-18333234 | |
BINARY | O76071 | CIAO2A Q9H5X1 | 19 | EBI-725145, EBI-752069 | |
BINARY | O76071 | CIAO2B Q9Y3D0 | 24 | EBI-725145, EBI-744045 | |
BINARY | O76071 | ERCC2 P18074 | 2 | EBI-725145, EBI-6380590 | |
BINARY | O76071 | HAUS3 Q68CZ6 | 3 | EBI-725145, EBI-2558217 | |
BINARY | O76071 | MEOX1 P50221 | 3 | EBI-725145, EBI-2864512 | |
BINARY | O76071 | MEOX2 Q6FHY5 | 3 | EBI-725145, EBI-16439278 | |
BINARY | O76071 | MMS19 Q96T76 | 15 | EBI-725145, EBI-1044169 | |
BINARY | O76071 | MMS19 Q96T76-8 | 5 | EBI-725145, EBI-10190644 | |
BINARY | O76071 | PGRMC1 O00264 | 5 | EBI-725145, EBI-1045534 | |
BINARY | O76071 | RGS2 P41220 | 3 | EBI-725145, EBI-712388 | |
BINARY | O76071 | RSAD2 Q8WXG1 | 2 | EBI-725145, EBI-12736320 | |
BINARY | O76071 | SF1 Q15637 | 3 | EBI-725145, EBI-744603 | |
BINARY | O76071 | SHISA6 Q6ZSJ9 | 3 | EBI-725145, EBI-12037847 | |
BINARY | O76071 | SLC4A7 Q9Y6M7 | 3 | EBI-725145, EBI-1044546 | |
BINARY | O76071 | TCP10L Q8TDR4 | 3 | EBI-725145, EBI-3923210 | |
BINARY | O76071 | TOP3B O95985 | 4 | EBI-725145, EBI-373403 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 14-53 | WD 1 | ||||
Sequence: HPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICK | ||||||
Repeat | 59-98 | WD 2 | ||||
Sequence: GHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECV | ||||||
Repeat | 103-142 | WD 3 | ||||
Sequence: GHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYEC | ||||||
Repeat | 148-187 | WD 4 | ||||
Sequence: SHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCC | ||||||
Motif | 176-178 | LYR motif; required for interaction with HSC20 | ||||
Sequence: LYR | ||||||
Repeat | 192-231 | WD 5 | ||||
Sequence: GHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQG | ||||||
Repeat | 250-289 | WD 6 | ||||
Sequence: FHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQ | ||||||
Repeat | 301-339 | WD 7 | ||||
Sequence: AHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL |
Sequence similarities
Belongs to the WD repeat CIA1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length339
- Mass (Da)37,840
- Last updated1998-11-01 v1
- Checksum63A8D8257A204FC8
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 243 | in Ref. 5; BAD96977 | ||||
Sequence: C → G |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U63810 EMBL· GenBank· DDBJ | AAC24948.1 EMBL· GenBank· DDBJ | mRNA | ||
EF011618 EMBL· GenBank· DDBJ | ABK41108.1 EMBL· GenBank· DDBJ | mRNA | ||
AC004020 EMBL· GenBank· DDBJ | AAC23493.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CR456802 EMBL· GenBank· DDBJ | CAG33083.1 EMBL· GenBank· DDBJ | mRNA | ||
AK223257 EMBL· GenBank· DDBJ | BAD96977.1 EMBL· GenBank· DDBJ | mRNA | ||
BC001395 EMBL· GenBank· DDBJ | AAH01395.1 EMBL· GenBank· DDBJ | mRNA | ||
BC032812 EMBL· GenBank· DDBJ | AAH32812.1 EMBL· GenBank· DDBJ | mRNA |