O76038 · SEGN_HUMAN
- ProteinSecretagogin
- GeneSCGN
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids276 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 25 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 27 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 31 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 36 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 71 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 73 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 75 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 77 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 82 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 118 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 120 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 122 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 129 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 162 | Ca2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 164 | Ca2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 166 | Ca2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 168 | Ca2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 173 | Ca2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 210 | Ca2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 212 | Ca2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 214 | Ca2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 221 | Ca2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 254 | Ca2+ 6 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 256 | Ca2+ 6 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 258 | Ca2+ 6 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 260 | Ca2+ 6 (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 265 | Ca2+ 6 (UniProtKB | ChEBI) | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | dendrite | |
Cellular Component | extracellular region | |
Cellular Component | nucleus | |
Cellular Component | synapse | |
Cellular Component | terminal bouton | |
Cellular Component | transport vesicle membrane | |
Molecular Function | calcium ion binding | |
Biological Process | regulation of long-term synaptic potentiation | |
Biological Process | regulation of presynaptic cytosolic calcium ion concentration |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSecretagogin
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO76038
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cytoplasmic vesicle, secretory vesicle membrane ; Peripheral membrane protein
Note: Predominantly cytoplasmic. A small proportion is associated with secretory granules and membrane fractions (By similarity).
Detectable in human serum after ischemic neuronal damage
Detectable in human serum after ischemic neuronal damage
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_042710 | 216 | in dbSNP:rs6942245 | |||
Sequence: A → V |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 353 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000073636 | 1-276 | Secretagogin | |||
Sequence: MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed at high levels in the pancreatic islets of Langerhans and to a much lesser extent in the gastrointestinal tract (stomach, small intestine and colon), the adrenal medulla and cortex and the thyroid C-cells. In the brain, the expression is restricted to distinct subtypes of neurons with highest expression in the molecular layer of the cerebellum (stellate and basket cells), in the anterior part of the pituitary gland, in the thalamus, in the hypothalamus and in a subgroup of neocortical neurons.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O76038 | ABI2 Q9NYB9-2 | 3 | EBI-749420, EBI-11096309 | |
BINARY | O76038 | SNAP23 O00161 | 3 | EBI-749420, EBI-745000 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 12-47 | EF-hand 1 | ||||
Sequence: LDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMK | ||||||
Domain | 58-93 | EF-hand 2 | ||||
Sequence: NLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDEN | ||||||
Domain | 105-140 | EF-hand 3 | ||||
Sequence: DSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLH | ||||||
Domain | 149-184 | EF-hand 4 | ||||
Sequence: KLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENF | ||||||
Domain | 197-232 | EF-hand 5 | ||||
Sequence: ERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMEL | ||||||
Domain | 240-276 | EF-hand 6 | ||||
Sequence: VDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length276
- Mass (Da)32,040
- Last updated2002-05-27 v2
- ChecksumEB970BF7B8763F33
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q96P10 | Q96P10_HUMAN | SCGN | 49 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 22 | in Ref. 1; CAA76365 | ||||
Sequence: Q → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y16752 EMBL· GenBank· DDBJ | CAA76365.1 EMBL· GenBank· DDBJ | mRNA | ||
AK289477 EMBL· GenBank· DDBJ | BAF82166.1 EMBL· GenBank· DDBJ | mRNA | ||
AL512384 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL022170 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471087 EMBL· GenBank· DDBJ | EAW55487.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC000336 EMBL· GenBank· DDBJ | AAH00336.1 EMBL· GenBank· DDBJ | mRNA | ||
BC003036 EMBL· GenBank· DDBJ | AAH03036.1 EMBL· GenBank· DDBJ | mRNA |